Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= SwissProt::Q9YGA6 (372 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 151 bits (382), Expect = 2e-41 Identities = 79/209 (37%), Positives = 134/209 (64%), Gaps = 11/209 (5%) Query: 15 EVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGI 74 E+T + +++LE++ GEF+ +LGPSGCGK+T L +IAGLE+PS G++++ K + P Sbjct: 18 EITVLEKINLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSEGKVFLNGKEILSPGP-- 75 Query: 75 FVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLN 134 D ++FQ AL+P + V DN+ F +KLR VP++E ++ + +++ LT+ + Sbjct: 76 -------DRIVMFQESALFPWLKVIDNVEFGMKLRGVPKKERYEKALKYLKMVHLTKFKD 128 Query: 135 RKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTI 194 +LSGG +QRVAL RA+ +V LMDEP + LD++ + + EL+++ + T I Sbjct: 129 AYVHQLSGGMKQRVALARALTLDSEVMLMDEPFAALDSQTKNILLLELQRIWWETKKTII 188 Query: 195 YVTHDQVEAMTMGDRIAVM--NRGVLQQV 221 +VTH+ EA+ + D++ VM N G +++V Sbjct: 189 FVTHNIEEAVLLADKVVVMSSNPGKIKKV 217 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 279 Length adjustment: 28 Effective length of query: 344 Effective length of database: 251 Effective search space: 86344 Effective search space used: 86344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory