Align 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase; DKGP aldolase; EC 4.1.2.29 (characterized)
to candidate WP_013289899.1 CALHY_RS10305 class II fructose-1,6-bisphosphate aldolase
Query= SwissProt::P42420 (290 letters) >NCBI__GCF_000166355.1:WP_013289899.1 Length = 323 Score = 207 bits (526), Expect = 3e-58 Identities = 121/313 (38%), Positives = 181/313 (57%), Gaps = 31/313 (9%) Query: 1 MAFVSMKELLEDAKREQYAIGQFNINGLQWTKAILQAAQKEQSPVIAAASDRLVDYLGGF 60 M V+ +E+ + A +YAIG FN+N ++ + I++AA++EQ+P+I S Y Sbjct: 1 MPLVTTREMFKKAAEGKYAIGAFNVNNMEIIQGIVEAAKEEQAPLILQVSAGARKYAKHI 60 Query: 61 KTIAAMVGALIEDMAITVPVVLHLDHGSSAERCRQAIDAGFSSVMIDGSHQPIDENIAMT 120 I +V A +ED +P+ LHLDHG E C+ ID GF+SVMIDGS P +ENIA+T Sbjct: 61 YLIK-LVEAALEDSG-DLPIALHLDHGEDFEICKACIDGGFTSVMIDGSRLPFEENIALT 118 Query: 121 KEVTDYAAKHGVSVEAEVGTVGGMEDGLVGG---VRYADITECERIVKETNIDALAAALG 177 K+V +YA + GV VEAE+G + G+ED + + D + V+ T +D+LA A+G Sbjct: 119 KKVVEYAHERGVVVEAELGKLAGIEDNVKVAEHEAAFTDPDQAAEFVERTGVDSLAVAIG 178 Query: 178 SVHG--KYQGEPNLGFKEMEAISRM--TDIPLVLHGAS---------------------G 212 + HG K++G+P L F+ ++ I D P+VLHGAS G Sbjct: 179 TSHGAYKFKGDPRLDFERLQKIVEKLPKDFPIVLHGASTVLPEFVEMCNKYGGNIPGAKG 238 Query: 213 IPQDQIKKAITLGHAKININTECMVAWTDETRRMFQENSDLYEPRGYLTPGIEAVEETVR 272 +P+D ++KA LG KINI+T+ +A T R+ E+ D ++PR YL G +A++E V+ Sbjct: 239 VPEDMLRKAAELGVRKINIDTDLRLAMTAAIRKHLYEHPDHFDPRQYLKDGRDAIKEMVK 298 Query: 273 SKMRE-FGSAGKA 284 K+R G AGKA Sbjct: 299 HKLRNVLGCAGKA 311 Lambda K H 0.316 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 323 Length adjustment: 27 Effective length of query: 263 Effective length of database: 296 Effective search space: 77848 Effective search space used: 77848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory