Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= CharProtDB::CH_001555 (400 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 186 bits (471), Expect = 1e-51 Identities = 98/242 (40%), Positives = 154/242 (63%), Gaps = 2/242 (0%) Query: 33 QILEKTGLSLGVKD-ASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVD 91 +I G+ + D +L IE+G+IF I+G SG+GKST++R +N L +PT G + IDGV+ Sbjct: 9 KIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHGSIEIDGVE 68 Query: 92 IAKISDAELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQ 151 + K+S EL+E+R KK+ ++FQ F L+ TV N AF +E+AG++ + + + L Sbjct: 69 MTKLSPTELKEMR-KKVGIIFQHFNLLSSRTVKGNVAFPLEIAGLDKKTIDNRVKELLEL 127 Query: 152 VGLENYAHSYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQ 211 VGL N SYP +LSGG +QRVG+ARALA NP +LL DEA SALDP + + L ++ Sbjct: 128 VGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSILNLLKEIN 187 Query: 212 AKHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDIS 271 + TIV ++H+++ +I +++A+M+ G++V+ G EI NP + F R + S Sbjct: 188 REFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFANPKTKIAQNFLRSLTFS 247 Query: 272 QV 273 ++ Sbjct: 248 EL 249 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 343 Length adjustment: 30 Effective length of query: 370 Effective length of database: 313 Effective search space: 115810 Effective search space used: 115810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory