Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_013402768.1 CALHY_RS04225 ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >NCBI__GCF_000166355.1:WP_013402768.1 Length = 261 Score = 141 bits (355), Expect = 2e-38 Identities = 89/243 (36%), Positives = 129/243 (53%), Gaps = 16/243 (6%) Query: 7 RGIEKFFGEHRAIKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSLMLDGRD 66 + I K+FG + + + L + +GE +V +GPSG GKST LR + LE I+ G + +DG Sbjct: 16 KNIVKYFGHNLVLDKVSLEVNRGEVVVIIGPSGSGKSTFLRCLNHLERINSGYIEIDGFV 75 Query: 67 ITD--------QPSSKR------DLAMVFQSYALYPHMSVYENMSFA-LKLAKVDKQVID 111 I D + SSK + MVFQ + L+PHM+ EN+ + + K+ K+ Sbjct: 76 IEDKGFHEKHKKHSSKEIARFCSQIGMVFQRFNLFPHMTALENVIVGPVVVNKMKKEEAV 135 Query: 112 EKVQNAARILNLTQYLQRTPKELSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQ 171 E + L P +LSGGQ+QRVAI RA+ PKV LFDEP S LD L G+ Sbjct: 136 ELGMELLEKVGLKDKANSYPAQLSGGQQQRVAIARALAMKPKVMLFDEPTSALDPELVGE 195 Query: 172 TRVEIAKLHRDLGATTIYVTHDQVEAMTLADRVVVLRDGIIEQVGTPLELYDKPANQFVA 231 + + K + G T + VTH+ A +ADRVV + G I + G P E++ P + Sbjct: 196 V-LNVMKELAEEGMTMLVVTHEMGFAREVADRVVFMDKGKIVEEGLPEEIFTNPKQERTR 254 Query: 232 QFI 234 QF+ Sbjct: 255 QFL 257 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 261 Length adjustment: 27 Effective length of query: 323 Effective length of database: 234 Effective search space: 75582 Effective search space used: 75582 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory