Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate WP_013404345.1 CALHY_RS12725 ABC transporter ATP-binding protein
Query= TCDB::Q97UF2 (371 letters) >NCBI__GCF_000166355.1:WP_013404345.1 Length = 257 Score = 137 bits (344), Expect = 4e-37 Identities = 77/201 (38%), Positives = 123/201 (61%), Gaps = 4/201 (1%) Query: 4 IRVENLSKIF--KKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPTS 61 + V +L KI+ + G V+A+ +VS +++ G ++G SG GKTT L +IAG ++PTS Sbjct: 6 LEVNSLKKIYTTRFGGNPVQALASVSFSVEQGEYIAIMGESGSGKTTLLNIIAGFDKPTS 65 Query: 62 GYIYFDNEAVSSPRRVMMSPEKRG-IAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKIE 120 G + + + ++S +S +R I VFQ++ L ++ DNI PL LA P ++ Sbjct: 66 GKVLLNGKEITSMNEKEISAFRRNNIGFVFQDYNLLDTFSIQDNILLPLVLAGRPYTEMY 125 Query: 121 NKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRES 180 ++K V+E+L +S +L++YP E+SGGQ QR AIARAL+ P+++L DEP LD+ E Sbjct: 126 ERLKPVAEKLRISDILSKYPYEVSGGQKQRAAIARALITKPQLILADEPTGALDSHSSEE 185 Query: 181 ARALVRKIQRERKLTTLIVSH 201 L +I E + T L+V+H Sbjct: 186 LLRLFAEINNEGQ-TILVVTH 205 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 257 Length adjustment: 27 Effective length of query: 344 Effective length of database: 230 Effective search space: 79120 Effective search space used: 79120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory