Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate WP_013402055.1 CALHY_RS00400 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc03063 (380 letters) >NCBI__GCF_000166355.1:WP_013402055.1 Length = 281 Score = 129 bits (323), Expect = 1e-34 Identities = 76/237 (32%), Positives = 133/237 (56%), Gaps = 10/237 (4%) Query: 146 PPRFTLDNYAEVLSAAGIG--RSFLNSLTVAVPSTVIPILIAAFAAYALAWMPFPGRAVL 203 P + + NY++++S + R FLNSL ++ ++ +L FAAY +A F ++ Sbjct: 52 PSKLSFFNYSQLISYGNMNIFRGFLNSLIISGSVVLLVLLFGGFAAYVIARFDFKLTGIV 111 Query: 204 LAVVVGLLVVPLQMSLIPLLQLYNGVGAFFGVSAKTYMGIWLAHTGFGLPLAIYLLRNYM 263 G ++VP +IP L + +G +Y+ + L T LP A L +M Sbjct: 112 KIFFTGAMLVPAFSIVIPSLVILRKLGL-----NGSYLALILPQTAGLLPFATLTLAGFM 166 Query: 264 AGLPREIMESARVDGASDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGD 323 LP E+ E+A +DGA IF +II+PLS P L + AIF FLW++NDL ++++F+ + Sbjct: 167 KTLPVELEEAAIIDGAGVLRIFFRIIVPLSIPGLVTAAIFVFLWSYNDLFMSLIFIPIRE 226 Query: 324 DKLVLTGRLVNLLGS-RGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKG 379 + + L++L+ S G N+ + A+ IT++ +I++ LQ Y+++G+ AG++KG Sbjct: 227 KQPICV--LLSLVSSIYGTNYGAMMAALIITVLPVIILYVFLQEYVIKGMTAGAIKG 281 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 281 Length adjustment: 28 Effective length of query: 352 Effective length of database: 253 Effective search space: 89056 Effective search space used: 89056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory