Align TreV, component of Trehalose porter (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 155 bits (391), Expect = 1e-42 Identities = 89/220 (40%), Positives = 141/220 (64%), Gaps = 9/220 (4%) Query: 1 MTVELIDIVKKY-GKN---IVINGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDK 56 M + + ++ KK+ KN V+ I +I+ GEF ILGPSG GKSTLL I+AG+EK + Sbjct: 1 MALAVENVSKKFLSKNKEITVLEKINLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSE 60 Query: 57 GKIIADGADITDKPPEKRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERVEKA 116 GK+ +G +I P++ ++FQ AL+P + V DN+ F +K+RG+ K+E E+ K Sbjct: 61 GKVFLNGKEILSPGPDR---IVMFQESALFPWLKVIDNVEFGMKLRGVPKKERYEKALKY 117 Query: 117 AKLLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARGELK 176 K++ +++ D V Q+SGG +QRVALARA+ + L+DEP + LD++ + EL+ Sbjct: 118 LKMVHLTKFKDAYVHQLSGGMKQRVALARALTLDSEVMLMDEPFAALDSQTKNILLLELQ 177 Query: 177 RIQKELKGTFIYVTHDQKEALSLADRIAIL--HKGKFEQV 214 RI E K T I+VTH+ +EA+ LAD++ ++ + GK ++V Sbjct: 178 RIWWETKKTIIFVTHNIEEAVLLADKVVVMSSNPGKIKKV 217 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 279 Length adjustment: 27 Effective length of query: 297 Effective length of database: 252 Effective search space: 74844 Effective search space used: 74844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory