Align TreV, component of Trehalose porter (characterized)
to candidate WP_013403450.1 CALHY_RS07950 methionine ABC transporter ATP-binding protein
Query= TCDB::Q97ZC0 (324 letters) >NCBI__GCF_000166355.1:WP_013403450.1 Length = 343 Score = 150 bits (379), Expect = 4e-41 Identities = 84/260 (32%), Positives = 144/260 (55%), Gaps = 10/260 (3%) Query: 3 VELIDIVKKYGKNIV----INGITEKIETGEFFVILGPSGEGKSTLLKILAGIEKLDKGK 58 + + ++ K Y N + ++ + IE G+ F I+GPSG GKSTL++ + +EK G Sbjct: 2 IRIKNLTKIYHSNGIDIKALDNVNLNIEKGDIFGIIGPSGAGKSTLIRCINMLEKPTHGS 61 Query: 59 IIADGADITDKPPE-----KRNVAMVFQNYALYPNMSVRDNIAFPLKMRGMKKEEIIERV 113 I DG ++T P ++ V ++FQ++ L + +V+ N+AFPL++ G+ K+ I RV Sbjct: 62 IEIDGVEMTKLSPTELKEMRKKVGIIFQHFNLLSSRTVKGNVAFPLEIAGLDKKTIDNRV 121 Query: 114 EKAAKLLGISEILDKKVTQISGGQQQRVALARAIVRNPSYFLLDEPLSNLDARVRTTARG 173 ++ +L+G++ D +Q+SGGQ+QRV +ARA+ NP L DE S LD + Sbjct: 122 KELLELVGLTNKTDSYPSQLSGGQKQRVGIARALANNPKVLLCDEATSALDPETTLSILN 181 Query: 174 ELKRIQKELKGTFIYVTHDQKEALSLADRIAILHKGKFEQVSDPKTLYEYPKTKWVAQFV 233 LK I +E T + VTH+ + +++A++ KG+ + ++ PKTK F+ Sbjct: 182 LLKEINREFGITIVVVTHEMNVVKQICNKVAVMEKGQIVEQGLLTEIFANPKTKIAQNFL 241 Query: 234 GEFPMNFLPGELMKEKAQEI 253 + LP EL K+K + + Sbjct: 242 RSLTFSELPEEL-KDKIRNL 260 Lambda K H 0.318 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 343 Length adjustment: 28 Effective length of query: 296 Effective length of database: 315 Effective search space: 93240 Effective search space used: 93240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory