Align Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)
to candidate WP_013402972.1 CALHY_RS05380 energy-coupling factor transporter ATPase
Query= uniprot:P70970 (276 letters) >NCBI__GCF_000166355.1:WP_013402972.1 Length = 288 Score = 239 bits (611), Expect = 4e-68 Identities = 123/262 (46%), Positives = 176/262 (67%), Gaps = 4/262 (1%) Query: 2 KTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQAG 61 KTPFE+ AL +IN SI +G ++ +IG TGSGKSTL+Q +NGLL P G + + Sbjct: 15 KTPFEKKALENINLSITKGEFIGIIGKTGSGKSTLVQLMNGLLVPQIGDVVVDGINT--- 71 Query: 62 KKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAREMLQLVGL 121 K K K++RK+VG+VFQ+PE+QLFEETV KDI+FGP N G +++ +++ +E+ +L+ + Sbjct: 72 KDKKRAKEIRKRVGLVFQYPEYQLFEETVYKDIAFGPQNLGFSEDEVKRRVKEVCELLEI 131 Query: 122 SEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQR 181 +ELL++SPFELSGGQ RR+AIAG+LAMDPE ++LDEPTAGLD RGRK I + +LH+ Sbjct: 132 PKELLEKSPFELSGGQKRRIAIAGILAMDPECIILDEPTAGLDMRGRKRIFSIIEKLHKE 191 Query: 182 GNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGEEMAGWGLDLPETIKFQ 241 T IL++HS+ED A + +I+++KG IQ G F E + GL LP I + Sbjct: 192 AKKTIILISHSLEDVAMLCERVIILNKGKIQFDGPKHQAFENVELLEKSGL-LPPDILYL 250 Query: 242 RHLEAALGVRFNEPMLTIEDAA 263 +H G + + ++E A Sbjct: 251 QHRLKLKGFKIDRFEYSVEKVA 272 Lambda K H 0.318 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 288 Length adjustment: 26 Effective length of query: 250 Effective length of database: 262 Effective search space: 65500 Effective search space used: 65500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory