Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate WP_013403434.1 CALHY_RS07865 ABC transporter ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >NCBI__GCF_000166355.1:WP_013403434.1 Length = 279 Score = 150 bits (380), Expect = 3e-41 Identities = 80/196 (40%), Positives = 128/196 (65%), Gaps = 5/196 (2%) Query: 22 INLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIGGRDVTTVEPADRDLAMVF 81 INL+I+ GEF+ +GPSGCGKSTLL +AGLE S G++ + G+++ + P D ++F Sbjct: 25 INLEIQKGEFICILGPSGCGKSTLLNIIAGLEKPSEGKVFLNGKEILSPGP---DRIVMF 81 Query: 82 QSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQLEDYLDRKPGQLSGGQRQR 141 Q AL+P + V +N+EFGMK+ G R E+ + +++ L + D QLSGG +QR Sbjct: 82 QESALFPWLKVIDNVEFGMKLRGVPKKERYEKALKYLKMVHLTKFKDAYVHQLSGGMKQR 141 Query: 142 VAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQLGATMIYVTHDQVEAMTMA 201 VA+ RA+ + V L DEP + LD++ + + +EL+ + + T+I+VTH+ EA+ +A Sbjct: 142 VALARALTLDSEVMLMDEPFAALDSQTKNILLLELQRIWWETKKTIIFVTHNIEEAVLLA 201 Query: 202 DKIVVL--NRGRIEQV 215 DK+VV+ N G+I++V Sbjct: 202 DKVVVMSSNPGKIKKV 217 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 279 Length adjustment: 27 Effective length of query: 311 Effective length of database: 252 Effective search space: 78372 Effective search space used: 78372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory