Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_013431217.1 CALKRO_RS11725 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_000166775.1:WP_013431217.1 Length = 358 Score = 146 bits (368), Expect = 9e-40 Identities = 102/335 (30%), Positives = 169/335 (50%), Gaps = 16/335 (4%) Query: 9 LLWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLRLPRSLVAV 68 +L+ + +A L +I + + +S +D +A L G + +V ++RL R + A+ Sbjct: 23 VLFLITIAILTVILSIYAISSGSSDLSFSDVLKAFL-GKSDERTALIVFDIRLVRIIAAI 81 Query: 69 LIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMAL---------TSALSPTPIAGY 119 L G LA+ G +Q+L HNP+ASP LGI+ GAA A+ S+ + + Sbjct: 82 LAGIGLAIGGAAIQSLFHNPLASPFTLGISQGAAFGAAIGIIVLGGGVASSAASDSVTIL 141 Query: 120 SLSFIAAC---GGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAED 176 S + AC G +S ++V+ R + + ++L+G+ALS+ T I A D Sbjct: 142 HPSLVVACAFSGSMLSTVIVLALAQVKRFSPEA--VVLSGVALSSLFSAATTIIQYFASD 199 Query: 177 -HAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNL 235 + +W G + A W DV + +V+ L + N + + A +LGVN+ Sbjct: 200 VKIAALVFWTFGDIGRATWNDVKIMAVLVILGWLYFLANSWNYNAIASGEDVAKSLGVNV 259 Query: 236 TRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLML 295 R R ++ + VS G + FI L+ PH+AR + G DQR + S L+GA L+L Sbjct: 260 ERTRFFGILVSSFITSVIVSFLGIIGFICLVAPHIARRFIGNDQRFLTMASGLVGAFLLL 319 Query: 296 LADVLARALAFPGDLPAGAVLALIGSPCFVWLVRR 330 L+D +AR + P LP GAV + +G+P F++L+ R Sbjct: 320 LSDTVARLIIQPVVLPVGAVTSFLGAPLFMYLLIR 354 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 358 Length adjustment: 29 Effective length of query: 303 Effective length of database: 329 Effective search space: 99687 Effective search space used: 99687 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory