Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_013429352.1 CALKRO_RS01420 sugar ABC transporter permease
Query= uniprot:C8WUQ9 (301 letters) >NCBI__GCF_000166775.1:WP_013429352.1 Length = 289 Score = 263 bits (672), Expect = 4e-75 Identities = 126/286 (44%), Positives = 188/286 (65%), Gaps = 8/286 (2%) Query: 24 RRSMQPGEQVALWVSRIVIWCVIVMVLLPMWFVVIASFNPSNSYISFSLFPSNASLANYK 83 R M + + LW+SR++IW I++ LLP WF+++AS + ++ S FP + NY Sbjct: 4 REYMTKQDAIVLWISRVIIWVAIILSLLPTWFIIVASLSKGGAFFQSSFFPKEITFENYI 63 Query: 84 ALFQGGQ--------FWTWVRNSLVVGVVVAMAQSFITAMSAFAFSKLRFYGRKYGLMTL 135 LF+ F WV+NSL+V VA Q F+TA +A+AFS++ F GRK GL TL Sbjct: 64 ELFRRKSSPSQTLPDFVMWVKNSLIVCFGVAFLQIFMTAPAAYAFSRINFVGRKNGLKTL 123 Query: 136 LLLQMFPNILAIAAFYTALAKLNMIDMLGSYILVMLGTSAFNIWLLKGYMDSVPKELDEA 195 L+LQMFP +A+ A Y LAK N++D L + ILV+ G SAFNIWLLKG MD +P E+DEA Sbjct: 124 LILQMFPTFMAMPAIYGLLAKFNLLDNLFALILVLAGGSAFNIWLLKGNMDQIPYEIDEA 183 Query: 196 AVIDGATTWQRFIHVTLPLSTPMMVVIFFLTLVGIFSEYMFAGTILQSPWNYTLGVGMYN 255 A+IDGA + F + LPL+ PM+ V+F + G+F+E++ + +LQSP N T+ +G+ N Sbjct: 184 AIIDGAGHFLIFRKIILPLTAPMLAVMFIWSFNGVFNEFLLSSLVLQSPENATVPIGLRN 243 Query: 256 LISGQFAKNWGEFAAAALLSAVPLAIVFAVAQRYLTKGLVAGSVKG 301 I+ QF+ NW F+AA++L+++P+ I++ Q+ + GL AG++KG Sbjct: 244 FINNQFSANWPMFSAASILASLPIVIIYMALQKQIQSGLAAGAIKG 289 Lambda K H 0.328 0.136 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 289 Length adjustment: 26 Effective length of query: 275 Effective length of database: 263 Effective search space: 72325 Effective search space used: 72325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory