Align Fructokinase; EC 2.7.1.4 (uncharacterized)
to candidate WP_013430927.1 CALKRO_RS10160 ROK family transcriptional regulator
Query= curated2:P43468 (288 letters) >NCBI__GCF_000166775.1:WP_013430927.1 Length = 399 Score = 58.2 bits (139), Expect = 3e-13 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 7/107 (6%) Query: 54 IGIGSFGPIGVNPHDPKYGYITTTPKPGWGDFDFLGHLKSQFNIPLYWTTDVNEAAYGES 113 IGIG G + + + G + P W + ++ +FN+P+Y + N A GE Sbjct: 143 IGIGVPGIV-----EKESGIVLIAPNLKWKNVHLKSIVQQRFNLPVYIDNEANAGALGEK 197 Query: 114 MIGIAKDVPNSIYMTIGTGVGAGVISQNHIFNGRT--HTELGHMRLN 158 G V + IY+++G G+GAG+I N +F G E+GH +N Sbjct: 198 WFGEWGKVSDLIYLSVGIGLGAGIIIDNKLFRGAAGFAGEVGHTTIN 244 Lambda K H 0.319 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 288 Number of extensions: 23 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 399 Length adjustment: 28 Effective length of query: 260 Effective length of database: 371 Effective search space: 96460 Effective search space used: 96460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory