Protein WP_007155514.1 in Marinobacter algicola DG893
Annotation: NCBI__GCF_000170835.1:WP_007155514.1
Length: 296 amino acids
Source: GCF_000170835.1 in NCBI
Candidate for 27 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| D-maltose catabolism | malG | hi | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 82% | 100% | 501.5 | ABC-type maltose transporter (subunit 1/2) (EC 7.5.2.1) | 44% | 183.3 |
| D-maltose catabolism | malG_Aa | lo | Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) | 37% | 85% | 183.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-maltose catabolism | malG_Bb | lo | ABC-type Maltose/ Maltodextrin permease (characterized, see rationale) | 33% | 98% | 161.4 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-maltose catabolism | malG_Sm | lo | MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 34% | 95% | 144.1 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| trehalose catabolism | malG | lo | MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 34% | 95% | 144.1 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-maltose catabolism | thuG | lo | Trehalose/maltose transport system permease protein MalG (characterized) | 31% | 95% | 128.6 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| trehalose catabolism | thuG | lo | Trehalose/maltose transport system permease protein MalG (characterized) | 31% | 95% | 128.6 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| L-fucose catabolism | SM_b21105 | lo | ABC transporter for L-Fucose, permease component 2 (characterized) | 31% | 97% | 122.1 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| sucrose catabolism | thuG | lo | ABC transporter for D-Trehalose, permease component 2 (characterized) | 30% | 94% | 121.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-cellobiose catabolism | msdB2 | lo | Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) | 33% | 76% | 116.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-sorbitol (glucitol) catabolism | mtlG | lo | ABC transporter for D-Sorbitol, permease component 1 (characterized) | 34% | 71% | 102.4 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-cellobiose catabolism | gtsC | lo | Sugar ABC transporter permease (characterized, see rationale) | 31% | 92% | 101.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-glucose catabolism | gtsC | lo | Sugar ABC transporter permease (characterized, see rationale) | 31% | 92% | 101.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| lactose catabolism | gtsC | lo | Sugar ABC transporter permease (characterized, see rationale) | 31% | 92% | 101.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-maltose catabolism | gtsC | lo | Sugar ABC transporter permease (characterized, see rationale) | 31% | 92% | 101.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| sucrose catabolism | gtsC | lo | Sugar ABC transporter permease (characterized, see rationale) | 31% | 92% | 101.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| trehalose catabolism | gtsC | lo | Sugar ABC transporter permease (characterized, see rationale) | 31% | 92% | 101.3 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-mannose catabolism | TT_C0326 | lo | Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) | 31% | 76% | 99.8 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-cellobiose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-glucose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| lactose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-maltose catabolism | aglG | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| D-maltose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| sucrose catabolism | aglG | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| sucrose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| trehalose catabolism | aglG | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
| trehalose catabolism | aglG' | lo | Inner membrane ABC transporter permease protein (characterized, see rationale) | 31% | 54% | 94.7 | Maltose-transporting ATPase (EC 3.6.3.19) | 82% | 501.5 |
Sequence Analysis Tools
View WP_007155514.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MAMVQPRSTKYRVLASHLGMLGFIVIILFPLLMVISISFRSGNFASGSLLPENPSLEHWY
LALGIPYTGEDGTVTQPPFPVLLWLWNSIKIAVISSVMILALSTTSAYAFARMRFAGKGF
VLKSMLIFQMFPPVLSLVALYALFDQIGNHVSWLGLNTHGAVIVASLGGMALHIWTIKGY
FDSIDRSLEEAAIVDGATTWQAFRYILLPLSVPILVVVFILAFIMTIMEYPMASVLLVDT
DKLTLAVGAQQYLYEQNYLWGDFAAAAVLSGLPITLIFLYCQKWIVGGLTAGGVKG
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory