Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_007152421.1 MDG893_RS03900 2-hydroxymuconic semialdehyde dehydrogenase
Query= metacyc::MONOMER-11560 (497 letters) >NCBI__GCF_000170835.1:WP_007152421.1 Length = 486 Score = 337 bits (864), Expect = 6e-97 Identities = 192/483 (39%), Positives = 277/483 (57%), Gaps = 11/483 (2%) Query: 23 FINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAPAK 82 +ING+Y + SG+ F+ ++P +G ++KV + + AV+ A+A N G W ++ + Sbjct: 7 YINGQYVGSASGKLFDNINPTNGLLISKVHEAGREEVDAAVKAAKAALN-GPWGKMTLEQ 65 Query: 83 RKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYDEV 142 R L + AD + +E E LD GKP +S IDIP A A+ + V E Sbjct: 66 RSGILHKVADGINARFDEFLEAECLDTGKPKSMASHIDIPRGAANFKVFADMVKNVPTES 125 Query: 143 --APTPHDQ--LGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPL 198 PTP L R P GV+G I PWN PLL+ WK+GPALA GN+VV+KPSE++P Sbjct: 126 FEMPTPDGTGALNYAVRRPKGVIGVISPWNLPLLLMTWKVGPALACGNTVVVKPSEETPT 185 Query: 199 TAIRIAQLAIEAGIPAGVLNVLPGYG-HTVGKALALHMDVDTLVFTGSTKIAKQLMVYAG 257 T + ++ ++G+P GV NV+ G+G + G L H VD FTG T + +M A Sbjct: 186 TTALLGEVMKDSGVPDGVFNVVHGFGGDSAGAFLTEHPLVDGFTFTGETGTGEVIMKAAA 245 Query: 258 ESNMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDK 317 + ++ I LE GGK+ +VFAD D+ A E + N G+VC R+ VERSI D+ Sbjct: 246 KG-IRDISLELGGKNAGLVFADC-DMDKAIEGTMRSAFANCGQVCLGTERVYVERSIFDE 303 Query: 318 FLPMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGG---KRT 374 F+ + EA +G K G P D + +G LV + VLSY + DGA ++ GG Sbjct: 304 FVGRLKEAAEGMKIGPPDDAEADMGPLVSLKHREKVLSYYQKAVDDGAMVVTGGGVPDMP 363 Query: 375 LEETGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIW 434 E GG +V+PTI+ G+ + + +EIFGP + + FDT EEA+ +AN PYGLA+ IW Sbjct: 364 EELVGGAWVQPTIWTGLPESSTVITDEIFGPCVHLCPFDTEEEAIELANSLPYGLASAIW 423 Query: 435 TSDISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATW 494 + +I++AH+ A V AG +WVN + D+ PFGG KQSG GR+ +H+LE YTE+K Sbjct: 424 SENITRAHRVAGQVEAGIIWVNSWFLRDLRTPFGGSKQSGIGREGGVHSLEFYTEMKNIC 483 Query: 495 IKL 497 +KL Sbjct: 484 VKL 486 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 645 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 486 Length adjustment: 34 Effective length of query: 463 Effective length of database: 452 Effective search space: 209276 Effective search space used: 209276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory