Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_007153015.1 MDG893_RS06845 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Korea:Ga0059261_1644 (347 letters) >NCBI__GCF_000170835.1:WP_007153015.1 Length = 610 Score = 145 bits (367), Expect = 2e-39 Identities = 105/310 (33%), Positives = 161/310 (51%), Gaps = 21/310 (6%) Query: 51 VVTCARGSSDHAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSP 110 ++ C G+S HA A+Y IE L GVP S ++ Y V + L L ISQSG++ Sbjct: 299 IIAC--GTSYHAGMVARYWIEELAGVP-CSVEVASEFRYRKHVIQPDTLFLCISQSGETA 355 Query: 111 DLLATVEHQRKAG-AFVVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIA 169 D LA + +KAG +A+ N S L +D+VI +AGPE VA+TK++ L A+ Sbjct: 356 DTLAALRQAKKAGFRAAMAICNVPGSSLVRESDLVIMTQAGPEIGVASTKAFTTQLTALL 415 Query: 170 ALVAAWAQDEALET--------AVADLPAQLERAFALDWSAAVTALT--GASGLFVLGRG 219 A A+ LE A+ LP+Q+++ ALD A + + + LGRG Sbjct: 416 IFTLALARHNGLEESREAEIVEAIRLLPSQVDQVLALDGDIAEMSKSFMDKNHSLFLGRG 475 Query: 220 YGYGIAQEAALKFKETCALHAESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETV 279 + +A E ALK KE +HAE++ A E++HGP+A+V V+ A ++ E ++ + Sbjct: 476 AMFPVALEGALKLKEISYIHAEAYPAGELKHGPLALVDGEMPVVTVAPNNELLEKLKSNL 535 Query: 280 AEFRSRGAEV-LLADPAA---RQAG---LPAIAAHPAIEPILIVQSFYKMANALALARGC 332 E R+RG E+ + AD AA Q G +P + HP PI+ ++ +A+ +G Sbjct: 536 EEVRARGGELFVFADQAADVRPQEGIHVMPLPSVHPITSPIVYTVPLQLLSYHVAVLKGT 595 Query: 333 DPDSPPHLNK 342 D D P +L K Sbjct: 596 DVDQPRNLAK 605 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 610 Length adjustment: 33 Effective length of query: 314 Effective length of database: 577 Effective search space: 181178 Effective search space used: 181178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory