Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_007155128.1 MDG893_RS17335 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000170835.1:WP_007155128.1 Length = 262 Score = 173 bits (439), Expect = 3e-48 Identities = 97/252 (38%), Positives = 149/252 (59%), Gaps = 6/252 (2%) Query: 14 PESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQG 73 P S++L + L+K F G A+ I VK GSI LIGPNGAGKTT FNLL+ F++P G Sbjct: 12 PSSTILETRNLTKDFKGFTAISDVSINVKTGSIHALIGPNGAGKTTFFNLLTKFLKPSAG 71 Query: 74 EVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINF 133 ++++ G I P IA +G +R+FQ++ V L+ EN+ +A Q + G + +F Sbjct: 72 QIIYAGKDITNARPAGIAQQGLIRSFQISAVFPHLSARENVRVALQRKLGISY-----HF 126 Query: 134 RRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEP 193 R + E+A A LE VGLG A A L+ GQ++ LE+A + P+L+LLDEP Sbjct: 127 WRPVRILDQLNEEAQATLEQVGLGPFADTKAVELAYGQKRALEIATTIALKPRLMLLDEP 186 Query: 194 AAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQI 253 G++ +G + E ++ G T +++EHN++V+ TL + VL G LA+G + + Sbjct: 187 TQGMSSEDVGTVTE-LIRKVVDGRTIVMVEHNLNVVSTLADTITVLNRGEVLAEGNYDTV 245 Query: 254 QSDPRVLEAYLG 265 ++P V+EAY+G Sbjct: 246 STNPAVMEAYMG 257 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 262 Length adjustment: 25 Effective length of query: 242 Effective length of database: 237 Effective search space: 57354 Effective search space used: 57354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory