Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate WP_007155005.1 MDG893_RS16740 2,3-dehydroadipyl-CoA hydratase
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000170835.1:WP_007155005.1 Length = 257 Score = 199 bits (505), Expect = 6e-56 Identities = 110/244 (45%), Positives = 152/244 (62%), Gaps = 4/244 (1%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADITQFNQLTPA 76 +TLNRPD LNALN LL L +A+ AE+DPE+R I+ITG KAF AGADI N++ Sbjct: 17 LTLNRPDVLNALNTDLLNNLSKALDDAEADPEVRAIVITGNQKAFAAGADI---NEMAAR 73 Query: 77 EAWKFSKKGREI-MDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPEIN 135 + + R ++I +KP IA +NG+ALGGG ELA+ DI IA E A+ G PEIN Sbjct: 74 DLVGILEDPRVAHWERIARFTKPIIAAVNGFALGGGCELAMHADILIAGENARFGQPEIN 133 Query: 136 LGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRKLA 195 LGI PG GGTQRLTR +G+ A+ M +TG++I A + GLV+ + + ++ Sbjct: 134 LGIMPGAGGTQRLTRKVGEALAMHMALTGEQINATRALQAGLVSEISQPELTVERAIEIG 193 Query: 196 EKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKREPT 255 + IA+K+PI++ L KE V + D L GL E + ++ T D++EG+ AF EKR P Sbjct: 194 QTIARKAPIAVRLTKESVRKADDMSLSDGLRFERHAFTLLAGTADRQEGLDAFREKRSPR 253 Query: 256 FKGK 259 F G+ Sbjct: 254 FNGQ 257 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 257 Length adjustment: 24 Effective length of query: 235 Effective length of database: 233 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory