Align Probable galactose dehydrogenase GalD; EC 1.1.1.- (characterized)
to candidate WP_014266824.1 ACIX8_RS18095 glucose 1-dehydrogenase
Query= SwissProt::Q92RN6 (256 letters) >NCBI__GCF_000178955.2:WP_014266824.1 Length = 259 Score = 131 bits (329), Expect = 2e-35 Identities = 89/242 (36%), Positives = 119/242 (49%), Gaps = 12/242 (4%) Query: 17 LVTGGGSGIGAALVEAFARQGARVAFVDI---AAESSLALCEKVAAQTGQAPHFIQADLR 73 LVTG SG+GAA+ A A+ GA VA A E+++A+ +K AA QADL Sbjct: 22 LVTGAASGLGAAIATALAQAGAEVAVHGNRRPATETAMAIGDKAAA--------FQADLS 73 Query: 74 NVEAVRAAADEAVAKLGSVRVLVNNAARDDRQALEAVTEESWDESLSVNLRHLFFMCQAV 133 + + + G V +LVNNA R A E E W L VNL +F + Q V Sbjct: 74 STSGAESLFGAVKERFGRVDILVNNAGTIHRNAAEDTLLEDWQHVLQVNLTSVFQLSQFV 133 Query: 134 APHM-QRQGGGSIVNFSSIAFLLNMPEIPAYSTAKAGIIGLTKSLAGKLGPDNIRVNAIL 192 A M R+ G IVN +S+ +PAY+ +K G+ LTK+LA + P IRVNAI Sbjct: 134 ARDMISREAAGKIVNIASLLSFQGGIRVPAYAASKGGVAQLTKALANEWAPKGIRVNAIA 193 Query: 193 PGMIVTERQRRLWLTEESIARMQERQCLKRMLVADDLVGPCLFLASDSSAAMTAQAMIID 252 PG T L E ++ ER R DL G LFL+S +S +T + +D Sbjct: 194 PGYFSTTNTEALQADETRNRQILERIPAARWGKPQDLAGAALFLSSAASNYVTGTVLTVD 253 Query: 253 GG 254 GG Sbjct: 254 GG 255 Lambda K H 0.321 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 259 Length adjustment: 24 Effective length of query: 232 Effective length of database: 235 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory