Align ADP-specific glucokinase (EC 2.7.1.147) (characterized)
to candidate WP_014265891.1 ACIX8_RS13435 ROK family protein
Query= BRENDA::Q8R8N4 (312 letters) >NCBI__GCF_000178955.2:WP_014265891.1 Length = 337 Score = 152 bits (385), Expect = 8e-42 Identities = 103/326 (31%), Positives = 158/326 (48%), Gaps = 31/326 (9%) Query: 3 IGVDLGGTNIAVGLVEEDGKIIATGSRPTKPERGYEAIARDIAELSFELLQRMGISVKDV 62 IGVDLGGTN+ + + + T PT+ G + + RD+ E + L + + Sbjct: 7 IGVDLGGTNLRIASYTDGTDFLDTILVPTRLAEGRDRVVRDMCE-AINALAIKDYGNRRL 65 Query: 63 KSMGIGVPGVADNEKGIVIRAVNL-FWTKVPLAKEIRKYIDLPIYMENDANVAALAEATF 121 +GIG PG + +GI+ NL W L + + + P+ +E+DAN+AALAE F Sbjct: 66 AGVGIGTPGPLELPEGILRNPPNLPGWDGFDLRQAVESTLGRPVEIESDANIAALAEFKF 125 Query: 122 GAGRGS--KSSVTITLGTGVGSGFILDGKIYSGAHHFAPEIGHMVIGD-NGIRCNCGKIG 178 GAGR KS +TLGTGVG+G IL I+ G+ E GH+V+ D G C CG G Sbjct: 126 GAGRAHNVKSLCMLTLGTGVGNGLILGKHIWHGSTGMGGEGGHIVVQDIGGAPCGCGGYG 185 Query: 179 CFETYASATALIREGKKAAKRNPNTLILKFANGDIEGITAKNVIDAAKQYDEEALKIFEE 238 C E YASA A++R + G T++ + A +++ L++FE Sbjct: 186 CLEQYASAPAIVRMAGELM-------------GPAAPSTSEEIAHLAMAGNQQCLQVFER 232 Query: 239 YVKYLAVGIVNIINLFDPEVIILGGGVANAGDFLLKPLKKEVAENILFKELPYADIRK-- 296 LA+G+ +IN + + ++GGGV A D + +E+ L D+ + Sbjct: 233 VGHALAIGLTGLINTLNLPLYLIGGGVCEAWDLFAPAMFRELPVRSYVYRLTAPDVLQPE 292 Query: 297 -----------AELGNDAGIIGAAIL 311 A+LG AG++GA +L Sbjct: 293 HLERHKTYILGAQLGPSAGLLGACLL 318 Lambda K H 0.318 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 337 Length adjustment: 28 Effective length of query: 284 Effective length of database: 309 Effective search space: 87756 Effective search space used: 87756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory