Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate WP_014263669.1 ACIX8_RS02120 phosphoglycerate dehydrogenase
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >NCBI__GCF_000178955.2:WP_014263669.1 Length = 540 Score = 172 bits (435), Expect = 2e-47 Identities = 114/323 (35%), Positives = 169/323 (52%), Gaps = 7/323 (2%) Query: 1 MKKIVAWKSLPEDVLAYLQQHA-QVVQVDATQHDAFVAALKDADG-GIGSSVKITPAMLE 58 MK ++A K P + + ++ VV D A L DAD + S+V+ A+L Sbjct: 1 MKIVLAEKVSPATLAIFQKEPGWNVVTADKIAPGGLPAELADADALVVRSAVQADAALLA 60 Query: 59 GATRLKALSTISVGFDQFDVADLTRRGIVLANTPDVLTESTADTVFSLILASARRVVELA 118 A +L+ + VG D D + TRRGIV+ NTP + A+ L+++ R + Sbjct: 61 AAPKLRIIGRAGVGVDNIDANEATRRGIVVMNTPGANAVAVAELTLGLMISMCRAIPRAN 120 Query: 119 EWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGGAVARRAALGFNMKVLYTNRSANPQ 178 + G W+ +L G +++GKTLGIVGLGRIG VARRA F M +L + P Sbjct: 121 AALHVGKWEKK---SLQGSELRGKTLGIVGLGRIGLEVARRAK-AFGMNLLGYDPFVAPV 176 Query: 179 AEEAYGARRVELAELLATADFVCLQVPLTPETKHLIGAAELKSMKKSAILINASRGATVD 238 G V + E+ +++DF+ L V LTP+T+ LI L MKK ++N +RG + Sbjct: 177 IARENGVTLVPIDEIFSSSDFLSLHVGLTPQTEGLINKTSLAIMKKGIRIVNCARGELIV 236 Query: 239 EKALIEALQNGTIHGAGLDVFETEPLPSDSPLLKLANVVALPHIGSATHETRHAMARNAA 298 ++AL EA+++G + GA LDVF EPL DSP +L NV+ PHI +T E + A+ A Sbjct: 237 DEALAEAIKSGHVAGAALDVFRHEPL-KDSPYFELENVLLSPHIAGSTDEAQEAIGIQLA 295 Query: 299 ENLVAALDGTLTSNIVNREVLSK 321 + L + N VN LS+ Sbjct: 296 NQVRDYLKLGVVQNAVNVASLSE 318 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 540 Length adjustment: 31 Effective length of query: 290 Effective length of database: 509 Effective search space: 147610 Effective search space used: 147610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory