Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_014266824.1 ACIX8_RS18095 glucose 1-dehydrogenase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_000178955.2:WP_014266824.1 Length = 259 Score = 164 bits (415), Expect = 2e-45 Identities = 110/264 (41%), Positives = 149/264 (56%), Gaps = 20/264 (7%) Query: 1 MTSTAQMPHILDLFRLDGRHALVTGGAQGIGFEIARGLAQAGARVTI-------ADLNPD 53 M+ + P ILDLFRLDG+ ALVTG A G+G IA LAQAGA V + + Sbjct: 1 MSISTTAPTILDLFRLDGKVALVTGAASGLGAAIATALAQAGAEVAVHGNRRPATETAMA 60 Query: 54 VGEGAA---RELDGTFERLNVTDADAVADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDW 110 +G+ AA +L T ++ A + R VD+LVNNAG + AEDT +DW Sbjct: 61 IGDKAAAFQADLSSTSGAESLFGA-----VKERFGRVDILVNNAGTIHRNAAEDTLLEDW 115 Query: 111 RAVLSVNLDGVFWCCREFGRTMLAR-GRGAIVSTASMSGLISNHPQPQAAYNASKAAVIH 169 + VL VNL VF + R M++R G IV+ AS+ P AY ASK V Sbjct: 116 QHVLQVNLTSVFQLSQFVARDMISREAAGKIVNIASLLSFQGGIRVP--AYAASKGGVAQ 173 Query: 170 LTRSLAGEWASRGVRVNAVAPGYTATPLTRRGLETPEWRETW-LKETPLGRLAEPREIAP 228 LT++LA EWA +G+RVNA+APGY +T T L+ E R L+ P R +P+++A Sbjct: 174 LTKALANEWAPKGIRVNAIAPGYFSTTNT-EALQADETRNRQILERIPAARWGKPQDLAG 232 Query: 229 AVLYLASDAASFVTGHTLVVDGGY 252 A L+L+S A+++VTG L VDGG+ Sbjct: 233 AALFLSSAASNYVTGTVLTVDGGW 256 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 259 Length adjustment: 24 Effective length of query: 231 Effective length of database: 235 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory