GapMind for catabolism of small carbon sources

 

Protein WP_013579038.1 in Granulicella tundricola MP5ACTX9

Annotation: NCBI__GCF_000178975.2:WP_013579038.1

Length: 260 amino acids

Source: GCF_000178975.2 in NCBI

Candidate for 20 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannose catabolism TM1750 med TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 45% 79% 235 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 42% 68% 173.7 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 37% 96% 172.9 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 37% 79% 168.3 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 33% 84% 162.5 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 38% 63% 159.1 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 34% 72% 152.1 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 37% 59% 151.8 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 37% 91% 146.4 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtP; EC 7.4.2.- (characterized) 35% 98% 144.4 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 35% 80% 138.3 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 63% 136 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
trehalose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 36% 63% 136 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 32% 89% 135.2 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-histidine catabolism hisP lo Histidine transport ATP-binding protein HisP (characterized) 33% 99% 135.2 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 97% 133.3 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 32% 58% 131.3 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 31% 74% 130.2 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 34% 62% 127.5 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 30% 89% 90.1 Oligopeptide transport ATP-binding protein OppF; Stage 0 sporulation protein KE 50% 249.6

Sequence Analysis Tools

View WP_013579038.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNAPLFEISGLTKQYGSKRVVDEVSFSIQRGETLGLVGESGSGKSTVARMLLRLVEPSAG
QIGFDGIDLLAAKTKKMRHLRRRIQMVFQDPYAALNPRMNIRQIISEPFAIQGGFSRDAV
RQRLDELMGDVGLSPDVLSRYPHEFSGGQRQRINIARALALKPEFLALDEPVSALDVSVG
AQVINLLKDLQRTHGLTYLFISHSMPLVRYLADRVAVMQNGKLVEIGDVLQVCERPREAY
TQRLIAATPRLPDEEWNARS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory