Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_008511119.1 BIBO1_RS18855 aspartate aminotransferase family protein
Query= reanno::SB2B:6938540 (460 letters) >NCBI__GCF_000182725.1:WP_008511119.1 Length = 442 Score = 273 bits (699), Expect = 6e-78 Identities = 167/436 (38%), Positives = 241/436 (55%), Gaps = 23/436 (5%) Query: 23 PFTDSADLAKRGTRVIERAEGVYIWDAKGNKLLDAMAGLWCVNVGYGRKSIADAAYAQLQ 82 PFT + K R++ A G+Y D GN++LD AGLWC N G+GRK I +A Q+ Sbjct: 16 PFTANRQF-KAAPRLLASASGMYYTDVDGNQVLDGTAGLWCCNAGHGRKRITEAVERQIS 74 Query: 83 TLPFYNNFFQCTHEPAIRLASKIASLAPG----HMNRVFFTGSGSEANDTNLRMVRRYWD 138 T+ F F Q H A A K+A++APG ++RVFFT SGSE+ DT L++ Y Sbjct: 75 TMDFAPTF-QMGHNVAFDFAEKLAAIAPGGAEAKLDRVFFTNSGSESVDTALKIAIAYQR 133 Query: 139 LKGMPSKKTIISRKNAYHGSTVAGASLGGMGFMHQQ-GDLPIPGIVH-ID-QPYWFGEGR 195 G ++ ++ R+ YHG G S+GG+ + +P + H +D + F +G Sbjct: 134 AIGQGTRTMVLGREKGYHGVGFGGISVGGLVNNRRVFPQIPADHLRHTLDIEKNSFSKGL 193 Query: 196 DMSPEAFGIKTAQALEAKILELGEDKVAAFIAEPFQGAGGVIIPPDSYWNEIKRILEKYN 255 A GI+ A LE + G +K+AA I EP G+ GVI+PP Y I+ +KY Sbjct: 194 P----ANGIELADDLERLVQLHGAEKIAAVIVEPMSGSAGVILPPKGYLERIRATADKYG 249 Query: 256 ILFILDEVISGFGRTGNWFAAQTLGLKPDLITIAKGMTSGYIPMGGVIVSDRVADVLIS- 314 IL I DEVI+GFGR G FA G+ PDL+T AKG+T+G IPMG V + +V D L++ Sbjct: 250 ILLIFDEVITGFGRLGTPFAVDYFGVVPDLVTTAKGLTNGAIPMGAVFAARKVYDGLMTG 309 Query: 315 --DGGEFAHGFTYSGHPVAAAVALENIRILEEERLVDKVRTDTGPYLQDRLQTLSAHPLV 372 + E HG+TYSGHPVA+A L + I EE L+ + Y Q+ L +L P V Sbjct: 310 PENAIELFHGYTYSGHPVASAAGLATLEIYAEEGLLTR-GAGLADYWQEALHSLKGAPNV 368 Query: 373 GEVRGMGMVGAIELVADKHSMVRFGSEISAGMLCREACIESGLVMRAVGDTMIISPPLCI 432 ++R +G+VGA+EL + K + +I C + GL++R GD + +SPPL I Sbjct: 369 IDIRNLGLVGAVELASRKDAPGARAYDIFV------ECFKKGLLIRVTGDVIALSPPLII 422 Query: 433 TRDEIDELIFKASQAL 448 +++ID +I A+ Sbjct: 423 EKEQIDTIISVLGDAI 438 Lambda K H 0.321 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 520 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 442 Length adjustment: 33 Effective length of query: 427 Effective length of database: 409 Effective search space: 174643 Effective search space used: 174643 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory