Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate WP_002967099.1 BIBO1_RS10785 aspartate aminotransferase family protein
Query= BRENDA::Q9I6J2 (456 letters) >NCBI__GCF_000182725.1:WP_002967099.1 Length = 456 Score = 366 bits (939), Expect = e-105 Identities = 185/453 (40%), Positives = 280/453 (61%), Gaps = 7/453 (1%) Query: 8 AKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNV 67 A+ +A +HL +TD +L +G +I + +G+Y+ D G + ++AM+GLW V V Sbjct: 3 AQPNSLEARDIRYHLHSYTDAVRLEAEGPLVIERGDGIYVEDIAGKRYIEAMSGLWSVGV 62 Query: 68 GYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEAN 127 G+ + L +AA RQM++LPFY+ F +H PV++LA+ + +AP M+ +FT SGSEAN Sbjct: 63 GFSEQRLAEAAARQMKKLPFYHTFSYRSHGPVIDLAEKLVAMAPVPMSKAYFTNSGSEAN 122 Query: 128 DTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIA 187 DTV++++ + G+P++K +I R GYHG T+A SL G+ H D PI I+H Sbjct: 123 DTVVKLIWYRSNALGEPERKKIISRKRGYHGVTIASASLTGLPNNHRSFDLPIDRILHTG 182 Query: 188 QPYWYGEG-GDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWP 246 P+ Y + S ++F A +LE+ IL G +AAFI EP+ GAGGV+VPP TYW Sbjct: 183 CPHHYHDALPGESEEQFATRLANELEQLILAEGPHTIAAFIGEPVMGAGGVVVPPKTYWE 242 Query: 247 KIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVR 306 K++ +L +Y+IL +ADEVICGFGRTG FG Q + PD++ ++K L+S Y+P+ ++ Sbjct: 243 KVQAVLGRYNILLVADEVICGFGRTGNLFGCQTFDIKPDILVMSKQLSSSYLPISAFLIN 302 Query: 307 DE----IVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKR 362 + I E ++ G GFT SGHPVAAAVALEN+ I+ E ++ + E +QKR Sbjct: 303 ERVYAPIAEESHKIGTLGTGFTASGHPVAAAVALENLAIIEERDLVANAR-ERGARMQKR 361 Query: 363 WQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKG-VGMLCREHCFRNGLIMRAVGD 421 +EL DHPLVGE RGVG++A +ELV +K+ + G +G G+I RA+GD Sbjct: 362 LRELQDHPLVGEVRGVGLIAGVELVIDKEAKTGLEQPGALGARANAALQERGVISRAMGD 421 Query: 422 TMIISPPLVIDPSQIDELITLARKCLDQTAAAV 454 T+ PPL+I+ Q+D +++ L+ A++ Sbjct: 422 TLAFCPPLIINDQQVDTMVSALEAALNDVQASL 454 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 456 Length adjustment: 33 Effective length of query: 423 Effective length of database: 423 Effective search space: 178929 Effective search space used: 178929 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory