Align ATPase (characterized, see rationale)
to candidate WP_004681962.1 BIBO1_RS17100 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000182725.1:WP_004681962.1 Length = 253 Score = 205 bits (522), Expect = 7e-58 Identities = 106/226 (46%), Positives = 146/226 (64%), Gaps = 6/226 (2%) Query: 41 VSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDR------RDIA 94 +++T+ G V ++GPSG GKST LR +N LE G + + G ++ + + I Sbjct: 20 INITIAEGTVTALVGPSGGGKSTLLRCINLLEIPTSGTLLLGGQSITFEPNRKPSWQTIQ 79 Query: 95 TIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKY 154 +IR++ GMVFQ F LFPH T +QN+M V V +WP +A A +LL +V +A +AD + Sbjct: 80 SIRRQTGMVFQNFQLFPHQTAIQNVMEGLVTVLKWPKNKARERAMELLTKVGMAHKADAW 139 Query: 155 PGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLASEGMTMLVAT 214 P LSGGQQQR+AIARALA PR+LL DEPTSALDPE+ EV+DV+ LA EG TM++AT Sbjct: 140 PSTLSGGQQQRIAIARALAPSPRVLLCDEPTSALDPELASEVVDVLSKLAQEGTTMVIAT 199 Query: 215 HEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQI 260 H++ A ++A VV + G +VE FT P +R KQF+A I Sbjct: 200 HDLRLASKIAKNVVFLETGNVVETGSAHDVFTHPTRERTKQFVATI 245 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 253 Length adjustment: 24 Effective length of query: 237 Effective length of database: 229 Effective search space: 54273 Effective search space used: 54273 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory