Align ATPase (characterized, see rationale)
to candidate WP_008508827.1 BIBO1_RS14870 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000182725.1:WP_008508827.1 Length = 258 Score = 230 bits (587), Expect = 2e-65 Identities = 121/239 (50%), Positives = 165/239 (69%), Gaps = 9/239 (3%) Query: 27 VEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRL 86 V K+YG F AL V L++ G+V ++GPSGSGKST LR +N LE + GEI I+G + Sbjct: 12 VNKYYG-PFHALRNVDLSIIPGKVTCLIGPSGSGKSTLLRCINFLEEYDSGEIVIDGQLI 70 Query: 87 SH--------DRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATA 138 + R + +R+ +GMVFQQFNL+PH+T LQN+ ++VR P ++AEA A Sbjct: 71 GYVSPGGRKMPGRKLREMRRSIGMVFQQFNLWPHMTALQNVAEGLIRVRGLPKSEAEARA 130 Query: 139 RQLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLD 198 + L++V +A++ +P +LSGGQQQRVAIARA+AM+PR++LFDEPTSALDPE+V EVL Sbjct: 131 AEALKKVGLADKMANHPSRLSGGQQQRVAIARAIAMEPRLMLFDEPTSALDPELVGEVLS 190 Query: 199 VMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFL 257 VM+ LASEGMTM+V THE+GFA VAD+V M G++V P + P+ R + FL Sbjct: 191 VMKTLASEGMTMVVVTHEMGFAAHVADQVAFMEKGELVGVGAPSQILHHPEDPRIESFL 249 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 258 Length adjustment: 24 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory