Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_008511698.1 BIBO1_RS20000 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000182725.1:WP_008511698.1 Length = 263 Score = 421 bits (1082), Expect = e-123 Identities = 204/254 (80%), Positives = 231/254 (90%), Gaps = 1/254 (0%) Query: 9 QVDRSHMQVSD-EIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRC 67 Q+DRS +++S ++AI+I M+KWYG+FHVLRDINL V RGERIV+AGPSGSGKSTMIRC Sbjct: 9 QIDRSKLEISKTDVAIEIKNMHKWYGEFHVLRDINLKVMRGERIVVAGPSGSGKSTMIRC 68 Query: 68 INRLEEHQSGKIIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVR 127 +NRLEEHQ G+IIVDGIELT+DLK ID+VR EVGMVFQHFNLFPHLTILEN TLAPIWVR Sbjct: 69 VNRLEEHQKGQIIVDGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVR 128 Query: 128 KVPKREAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSA 187 K+PK++AEE AM+YLE+VKIPEQA KYPGQLSGGQQQRVAIAR+LCM PK+MLFDEPTSA Sbjct: 129 KMPKKQAEEIAMHYLERVKIPEQANKYPGQLSGGQQQRVAIARALCMSPKVMLFDEPTSA 188 Query: 188 LDPEMIKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHN 247 LDPEM+KEVLDTM+ LA EGMTM+CVTHEMGFA+ VANRVIFM GQIVEQN+P +FF N Sbjct: 189 LDPEMVKEVLDTMVSLAAEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPDEFFDN 248 Query: 248 PQSERTKQFLSQIL 261 PQ ERTK FLSQIL Sbjct: 249 PQHERTKLFLSQIL 262 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 263 Length adjustment: 25 Effective length of query: 238 Effective length of database: 238 Effective search space: 56644 Effective search space used: 56644 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory