Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate WP_008506062.1 BIBO1_RS09825 iron ABC transporter permease
Query= CharProtDB::CH_004160 (318 letters) >NCBI__GCF_000182725.1:WP_008506062.1 Length = 333 Score = 203 bits (517), Expect = 4e-57 Identities = 129/324 (39%), Positives = 184/324 (56%), Gaps = 19/324 (5%) Query: 3 IALVIFITLALAGCALLSLHMGVIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLALFVG 62 + +V+F L G A L I ++ALL D + V+ E RLPR LLAL +G Sbjct: 17 LVIVLFAVSLLTGPAALG-----IGESFKALLGDDR--DMTVLVMREIRLPRALLALLIG 69 Query: 63 AALAVAGVLIQGIVRNPLASPDILGVNHAASLASV-----GALLLMPSLPVMVLPLLAFA 117 A+L ++G +QG +RNPLA P +LGV+ +ASL +V G LL P + LPLLA A Sbjct: 70 ASLGLSGAALQGYLRNPLAEPGLLGVSASASLGAVIAIYSGLSLLFP----LALPLLALA 125 Query: 118 GGMAGLILLKMLA-KTHQPMKLALTGVALSACWASLTDYLMLSRPQD--VNNALLWLTGS 174 G + L+K+LA + + + L GVA+++ +LT + P + W+ GS Sbjct: 126 GAFVSVFLVKLLAGRNAGTLAVILAGVAVTSLAGALTALALNLSPNPFAAMEIVFWMLGS 185 Query: 175 LWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLAVA 234 L R + V + IP +++ + LS R LD L LG A T+GVS+ + +A+L A Sbjct: 186 LADRSMTHVALVIPFILIGWLMLLSLGRSLDSLTLGSDAAATMGVSLGRVQLFAVLGTAA 245 Query: 235 MTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHPPL 294 A G I F+GLVVPH++R + G R RLL S L GA LL+ AD+L R++ P Sbjct: 246 CVGASTAVAGSIGFVGLVVPHLLRPLVGARPSRLLAASGLGGAALLLAADILVRVVMPGR 305 Query: 295 ELPVGVLTAIIGAPWFVWLLVRMR 318 EL +GVLTAIIGAP+F+WL+ + R Sbjct: 306 ELKLGVLTAIIGAPFFLWLVFKYR 329 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 333 Length adjustment: 28 Effective length of query: 290 Effective length of database: 305 Effective search space: 88450 Effective search space used: 88450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory