Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_002971117.1 BIBO1_RS07945 ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >NCBI__GCF_000182725.1:WP_002971117.1 Length = 240 Score = 160 bits (404), Expect = 3e-44 Identities = 80/206 (38%), Positives = 126/206 (61%) Query: 4 GYGAVILDGVWLTLQLALSSMVLAIVLGLIGVALRLSPIRWLAWLGDLYSTVIRGIPDLV 63 G+G I G+ +T+ LAL+++ + ++LG + + S + ++Y+T+ RG+P+L+ Sbjct: 14 GWGISIAKGLLVTVSLALATLPVGLILGFLVALGKQSSEPSMRLAANIYTTIFRGLPELL 73 Query: 64 LILLIFYGGQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKG 123 + L+++G L R+ +FG D I++N AG+ LGF+F +Y SE F AF AIP G Sbjct: 74 TLFLVYFGASLGLQRLLHLFGIDANIEINAFVAGMVALGFVFSSYSSEVFLSAFRAIPHG 133 Query: 124 QAEAGMAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQ 183 Q E G A G+S Q V+ PQ+IR+A+PG N WLVL K T+L+SV+ L D++ + Sbjct: 134 QYEGGYAVGLSRRQTMRMVIFPQLIRIALPGLANLWLVLLKDTSLVSVITLSDILRQTSI 193 Query: 184 AADATREPFTFFLAVAAMYLVITSVS 209 AA T+EPF FF +YL + +S Sbjct: 194 AARVTKEPFLFFGIACLLYLALAIIS 219 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 240 Length adjustment: 23 Effective length of query: 206 Effective length of database: 217 Effective search space: 44702 Effective search space used: 44702 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory