Align Gamma aminobutyrate transaminase 3, chloroplastic; Gamma-aminobutyrate transaminase isozyme 3; LeGABA-TP3; SlGABA-T3; EC 2.6.1.96 (characterized)
to candidate WP_002967099.1 BIBO1_RS10785 aspartate aminotransferase family protein
Query= SwissProt::Q84P52 (520 letters) >NCBI__GCF_000182725.1:WP_002967099.1 Length = 456 Score = 436 bits (1120), Expect = e-126 Identities = 216/456 (47%), Positives = 303/456 (66%), Gaps = 6/456 (1%) Query: 50 TSLKNDISATDVRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAG 109 T+ N + A D+R + L +T PLVI++ +G YV D+ GK+Y++A++G Sbjct: 2 TAQPNSLEARDIRYH-----LHSYTDAVRLEAEGPLVIERGDGIYVEDIAGKRYIEAMSG 56 Query: 110 LWCTSLGGNEPRLVAAATKQLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFT 169 LW +G +E RL AA +Q+ +L FYH+F RS P +DLA++L+ + M+KA+FT Sbjct: 57 LWSVGVGFSEQRLAEAAARQMKKLPFYHTFSYRSHGPVIDLAEKLVAMAPV-PMSKAYFT 115 Query: 170 NSGSEANDTQVKLVWYYNNALGRPDKKKFIARTKSYHGSTLISASLSGLPALHQQFDLPA 229 NSGSEANDT VKL+WY +NALG P++KK I+R + YHG T+ SASL+GLP H+ FDLP Sbjct: 116 NSGSEANDTVVKLIWYRSNALGEPERKKIISRKRGYHGVTIASASLTGLPNNHRSFDLPI 175 Query: 230 PFVLHTDCPHFWRFHQPGETEEEFSTRLANNLENLILKEGPETIAAFIAEPVMGAGGVIP 289 +LHT CPH + PGE+EE+F+TRLAN LE LIL EGP TIAAFI EPVMGAGGV+ Sbjct: 176 DRILHTGCPHHYHDALPGESEEQFATRLANELEQLILAEGPHTIAAFIGEPVMGAGGVVV 235 Query: 290 PPATYFEKVQAILKKYDILFIADEVICGFGRLGTMFGCEKYNIKPDLVSVAKALSSGYMP 349 PP TY+EKVQA+L +Y+IL +ADEVICGFGR G +FGC+ ++IKPD++ ++K LSS Y+P Sbjct: 236 PPKTYWEKVQAVLGRYNILLVADEVICGFGRTGNLFGCQTFDIKPDILVMSKQLSSSYLP 295 Query: 350 IGAVLVSPEVSDVIYSQSNKLGTFSHGFTYSGHPVSCAVALETLKIYKERNIIEQVNRIS 409 I A L++ V I +S+K+GT GFT SGHPV+ AVALE L I +ER+++ Sbjct: 296 ISAFLINERVYAPIAEESHKIGTLGTGFTASGHPVAAAVALENLAIIEERDLVANARERG 355 Query: 410 PKFQEGLKAFSDSPIIGEIRGTGLLHGTEFTDNKSPNDPFPPEWGIGAYFGARCEKHGVL 469 + Q+ L+ D P++GE+RG GL+ G E +K +GA A ++ GV+ Sbjct: 356 ARMQKRLRELQDHPLVGEVRGVGLIAGVELVIDKEAKTGLEQPGALGARANAALQERGVI 415 Query: 470 VRVAGDNIMMSPPYILSLEEIDELIIKYGKALKDTE 505 R GD + PP I++ +++D ++ AL D + Sbjct: 416 SRAMGDTLAFCPPLIINDQQVDTMVSALEAALNDVQ 451 Lambda K H 0.317 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 613 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 456 Length adjustment: 34 Effective length of query: 486 Effective length of database: 422 Effective search space: 205092 Effective search space used: 205092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory