Align Ornithine aminotransferase; OAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_008507916.1 BIBO1_RS13055 aspartate aminotransferase family protein
Query= SwissProt::P38021 (401 letters) >NCBI__GCF_000182725.1:WP_008507916.1 Length = 403 Score = 243 bits (620), Expect = 7e-69 Identities = 141/387 (36%), Positives = 205/387 (52%), Gaps = 9/387 (2%) Query: 14 TSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQAD 73 T H + Y+ + G W+ +G Y+D + + + GH HP +++ LK QA+ Sbjct: 6 TVHPLYDTYNRAALRFERGEGIWLITEDGERYIDFAAGIAVNSLGHSHPHLVETLKTQAE 65 Query: 74 KITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYEVKGVADN 133 K+ S + + + T + + N+GAEA+E A+K ARR+ Y V G + Sbjct: 66 KLWHLSNIYEIPAQEKLGRRLVENTFADKVFFTNSGAEALECAIKTARRYQY-VSGHPE- 123 Query: 134 QAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAAF 193 + II G FHGRT+ ++ + +Y GFGP + G +P+GD ALR AITP TA Sbjct: 124 RFRIITFEGAFHGRTLATIAAGGQAKYLEGFGPKVEGFDQVPFGDEAALRAAITPETAGI 183 Query: 194 LFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDM 253 L EPIQGE G+ PE FL+ IC E +L + DE+QTG+GRTGK FA +W GI PD+ Sbjct: 184 LLEPIQGEGGLRAFPEEFLRLVRQICDENGLLLLLDEVQTGVGRTGKFFAHEWAGIRPDI 243 Query: 254 YILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLEDEKLAD 313 + K +GGG FPI A E G HG+T+GGNPL AV A L+V+ + + Sbjct: 244 MAIAKGIGGG-FPIGACLATAEAAKGMTAGMHGTTYGGNPLGMAVGNAVLDVVLADGFME 302 Query: 314 RSLELGEYFKSELESIDS---PVIKEVRGRGLFIGVELTEAARPYCERLKEEGLLCKETH 370 K L S+ V+ E+RGRGL +G++ + L++E +L Sbjct: 303 NVQATALVMKQGLASLVDRYPNVVSEIRGRGLLMGLKCVVPNTSLIQALRDEHVLSVGAG 362 Query: 371 DTVIRFAPPLIISKEDLDWAIEKIKHV 397 D V+R PPLI + E+ A E +KH+ Sbjct: 363 DNVVRLLPPLITTPEE---AREALKHI 386 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 403 Length adjustment: 31 Effective length of query: 370 Effective length of database: 372 Effective search space: 137640 Effective search space used: 137640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory