Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_008505361.1 BIBO1_RS08590 glucose 1-dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000182725.1:WP_008505361.1 Length = 246 Score = 124 bits (310), Expect = 2e-33 Identities = 80/247 (32%), Positives = 132/247 (53%), Gaps = 17/247 (6%) Query: 15 VLISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPGT----VATRADVSDAA 70 V+++GGA+GIGE A A++ GA+V + D S+ + D+ G + + DV+D Sbjct: 8 VIVTGGASGIGEATARAFIREGAKVVIADFSDHGQQL-ADELAGAHEQALFIKTDVADTK 66 Query: 71 QIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVP 130 ++A+ E+ G LD++ NAGIA ID + +A WQ TI+INLT Y +A+ Sbjct: 67 AVQALIVRTVENYGRLDIMFANAGIAADAP-IDELDEAAWQKTIDINLTGVYLCDKYAID 125 Query: 131 MLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGI 190 ++ G +++ S+ +G + T YAA K + L ++LA + G +IRVNA+ PG Sbjct: 126 QMRSQGGGVIVNCGSIHSHVGKSGVTAYAAAKGGVKLLTQTLAIDYGPQNIRVNAVCPGY 185 Query: 191 VEGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTG 250 ++ P + +P+ + +Q + + R+ AE+VA LFL S A V G Sbjct: 186 IDTPLLK----------NIPD-DKKQALVALHPMGRLGRAEEVANAVLFLASDEASFVNG 234 Query: 251 QAISVDG 257 ++ VDG Sbjct: 235 ASLLVDG 241 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 246 Length adjustment: 24 Effective length of query: 238 Effective length of database: 222 Effective search space: 52836 Effective search space used: 52836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory