Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_025200128.1 BIBO1_RS11530 7-alpha-hydroxysteroid dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_000182725.1:WP_025200128.1 Length = 304 Score = 133 bits (335), Expect = 4e-36 Identities = 84/246 (34%), Positives = 132/246 (53%), Gaps = 16/246 (6%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHVCDV----SESALAVFRDKYPGTVATRADVSDAAQ 71 +++G AAGIG +A + +AGA V V D+ +E+ A R + +V+D Sbjct: 64 IVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAATIRQAGGKAIGLECNVTDEQH 123 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFAHHAVPM 131 EAV K + G + VLVNNAG GP +SD EW +NL + +R + A P Sbjct: 124 REAVIKAALDQFGKITVLVNNAGGGGPKPFDMPLSDFEW--AFKLNLFSVFRLSQLAAPH 181 Query: 132 LKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGIV 191 ++++ HG +L+I+S+AG Y ++K A+ L +++A ++G IRVNA+ PG + Sbjct: 182 MQKAGHGAILNISSMAGENTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRVNAIAPGAI 241 Query: 192 EGPRMDGVIRARAEQVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNVTGQ 251 + + V+ PE E + L L R+ A+D+A ALFLCSPAA ++GQ Sbjct: 242 KTDALATVL--------TPEIE--RAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQ 291 Query: 252 AISVDG 257 ++V G Sbjct: 292 VLTVSG 297 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 304 Length adjustment: 26 Effective length of query: 236 Effective length of database: 278 Effective search space: 65608 Effective search space used: 65608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory