Align Short-chain dehydrogenase (characterized, see rationale)
to candidate WP_008507129.1 BIBO1_RS11575 D-threitol dehydrogenase
Query= uniprot:A0A2E7P8M8 (258 letters) >NCBI__GCF_000182725.1:WP_008507129.1 Length = 257 Score = 105 bits (263), Expect = 7e-28 Identities = 85/261 (32%), Positives = 126/261 (48%), Gaps = 19/261 (7%) Query: 1 MDLN--LQDKVVIVTGGASGIGGAISLQLAAEGAIPVVFARSEPDPQFWARLTGLQPRAA 58 +DLN L +KV IVTGGASGIG AIS A+GA V S + A+ L A Sbjct: 8 IDLNFPLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAK--AKAEELGENAK 65 Query: 59 LFQLELQDEARCGEAVAETVRRFGRLDGLVNNAGV-----NDSVGLDAGRNEFVASLERN 113 F ++ + +A+ + +FG++D VN+AGV + + LD +L+ + Sbjct: 66 PFVCDVSSQQSVNDAITAVITQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGS 125 Query: 114 LIHYYVMAHYCVPHLKATRGAILNVSSKTALTGQGNTSGYCASKGAQLSLTREWAAALRD 173 + + + G I+N++S+ YCASK + +++ +AA Sbjct: 126 FLVTQAVGRAMI--AAGNGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGK 183 Query: 174 DGVRVNALIPAEVMTPLYEK-WIATFENPQEKLDAITSKIPLGKRFTTSEEMADMAVFLL 232 G+ VN L P V+T L +K W EK +A +IP G RF EE+A AVFL Sbjct: 184 HGICVNTLSPTIVLTELGKKAWAG------EKGEAAKKRIPAG-RFAYPEEIAAAAVFLA 236 Query: 233 SGRSSHTTGQWVFVDGGYTHL 253 S + TG + +DGGYT L Sbjct: 237 SAGADMITGADLLIDGGYTIL 257 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory