Align ABC transporter for D-glucosamine, permease component 1 (characterized)
to candidate WP_008511689.1 BIBO1_RS19985 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_21715 (220 letters) >NCBI__GCF_000182725.1:WP_008511689.1 Length = 323 Score = 134 bits (338), Expect = 2e-36 Identities = 74/216 (34%), Positives = 126/216 (58%), Gaps = 5/216 (2%) Query: 2 NYQLNFAAVWRDFDTLLA-GLGLGLELALVSIAIGCVIGLLMAFALLSKHRALRVLASVY 60 ++ L+F+ + R L+ G L ++ +SIAI +I L+ A A LS++ + L++ Y Sbjct: 102 SFDLSFSFIARKISFLITQGTVTTLYISAISIAIATIIALIGAIAKLSQNGVIYGLSTFY 161 Query: 61 VTVIRNTPILVLILLIYFALPSLGIRLDKLPSFIITLSLYAGAYLTEVFRGGLLSIPKGL 120 ++ R P+L+ I +IY LP +G + +P+ I+ LSL GAY+TE+FR G+ SIP G Sbjct: 162 TSLFRGLPLLMQIYIIYLGLPQIGYVIGAIPAGILALSLCYGAYMTEIFRAGIESIPHGQ 221 Query: 121 REAGLAIGLGEWQVKAYVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKI 180 +EA A+GLG Q V +P +R ++P N FI++ KD+SL + I V EL Y AR Sbjct: 222 KEAATALGLGSAQTMWLVILPQAMRIIIPPTGNQFIAMLKDSSLVSVIGVWELMYVARTQ 281 Query: 181 NVESYRVIETWLVTTALYVAACYLIAMLLRYLEQRL 216 +R IE + + +Y +++++ +++ R+ Sbjct: 282 GQTEFRHIEMLITASMIY----WILSISFEFIQSRI 313 Lambda K H 0.329 0.143 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 323 Length adjustment: 25 Effective length of query: 195 Effective length of database: 298 Effective search space: 58110 Effective search space used: 58110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory