Align Alpha-glycerophosphate oxidase; EC 1.1.3.21; Exported protein 6; Glycerol-3-phosphate oxidase (uncharacterized)
to candidate WP_008511011.1 BIBO1_RS18565 glycerol-3-phosphate dehydrogenase
Query= curated2:P35596 (608 letters) >NCBI__GCF_000182725.1:WP_008511011.1 Length = 502 Score = 178 bits (452), Expect = 4e-49 Identities = 167/558 (29%), Positives = 241/558 (43%), Gaps = 83/558 (14%) Query: 16 QERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSRSTKLVHGGLRYLKQF 75 + T DL +IGGGI GAGVA AA GL+ L E D A+GTSSRS KLVHGGLRYL+ + Sbjct: 3 EPETCDLFVIGGGINGAGVARDAAGRGLKVVLAEKDDLAQGTSSRSGKLVHGGLRYLEYY 62 Query: 76 DVEVVSDTVSERAVVQQIAPHIPKSDPMLLPVYDEDGATFSLFRLKVAMDLYDLLAGVSN 135 + +V + + ER V+ APHI +LP +D + +++ + LYD L G Sbjct: 63 EFRLVREALIEREVLLNAAPHIIWPMRFVLPHSPQDRPA---WLVRLGLFLYDHLGGRKK 119 Query: 136 TPAANKVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIENIKRANQDGALIANHV 195 P + L + E P L + G Y D +DARLV N A + GA I Sbjct: 120 LP-GTRTLDLKRDPEGTPIL--DQYTKGFEYSDCWVDDARLVALNAVGAAEKGATILTRT 176 Query: 196 KAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPW-SDKVRNLSNKGTQFSQMR 254 + G I V R+ T + +AR ++N GPW +D + N++ T +R Sbjct: 177 PVVSARRENGGWI--VETRNSDTGESRTFRARCIVNCAGPWVTDVIHNVA-ASTSSRNVR 233 Query: 255 PTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRE-NKTYFGTTDTDYTGDLEHPKV 313 KG H++V K Y D R++F+ P E +K GTTD Y G E Sbjct: 234 LVKGSHIIV--PKFWSGANAYLVQN-HDKRVIFINPYEGDKALIGTTDIAYEGRAEDVAA 290 Query: 314 TQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNGGNNGTISDESFDN 373 ++++DYL+ VN F E + +D+ S++G+RPL D+ N Sbjct: 291 DEKEIDYLITAVNRYFKE-KLRREDVLHSFSGVRPLF-----------------DDGKGN 332 Query: 374 LIATVESYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDRDDNG---LLTLAG 430 A Y+ D D+ G LL + G Sbjct: 333 PSAVTRDYV-----------------------------------FDLDETGGAPLLNVFG 357 Query: 431 GKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTY--PVSGGELNPANVDSEIEAFAQ 488 GKIT +R++AE M R+ I ++ T+ P+ GGE+ AN D E A Sbjct: 358 GKITTFRELAERGMHRLKHIFP-------QMGGDWTHDAPLPGGEI--ANADYETFANTL 408 Query: 489 LGVSRGLDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLAD--TLSLHYAMRNELTLS 546 + H+ LYG+ V A A +LE D + Y + E + Sbjct: 409 RDTYPWMPRTLVHHYGRLYGARTKDVVAGAQNLEGLGRHFGGDFHEAEVRYLVAREWAKT 468 Query: 547 PVDFLLRRTNHMLFMRDS 564 D L RRT H L + ++ Sbjct: 469 AEDILYRRTKHYLHLTEA 486 Lambda K H 0.314 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 654 Number of extensions: 35 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 608 Length of database: 502 Length adjustment: 36 Effective length of query: 572 Effective length of database: 466 Effective search space: 266552 Effective search space used: 266552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory