Align LacK, component of Lactose porter (characterized)
to candidate WP_008507759.1 BIBO1_RS12775 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_000182725.1:WP_008507759.1 Length = 363 Score = 338 bits (866), Expect = 2e-97 Identities = 191/370 (51%), Positives = 241/370 (65%), Gaps = 26/370 (7%) Query: 1 MAEVRLTDIRKSYGSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGEL 60 MA++ + ++ K YGS+EV+ G+NLE++ EFV VGPSGCGKST LRMIAGLE IS G L Sbjct: 1 MAQLSIKNLVKRYGSIEVVHGINLEIADKEFVALVGPSGCGKSTTLRMIAGLESISGGTL 60 Query: 61 TIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKI 120 IGG V+ND+ P R I+MVFQ+YALYPHM+VRENMGF+L+ A + EI+RRVN AA + Sbjct: 61 EIGGKVVNDLPPRDRNISMVFQSYALYPHMSVRENMGFSLKIAKQPQAEIDRRVNEAAAV 120 Query: 121 LELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLH 180 L L+ALMDR+P LSGGQRQRVA+GRAIVR P+VFLFDEPLSNLDA+LR MR EI +LH Sbjct: 121 LGLEALMDRRPAQLSGGQRQRVAMGRAIVRNPEVFLFDEPLSNLDAKLRTQMRTEIKKLH 180 Query: 181 KELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRMN 240 ++ +T+VYVTHDQVEAMTLAD+IV+MR G +EQ G P ++ P FVAGFIGSP MN Sbjct: 181 AKVQSTVVYVTHDQVEAMTLADRIVIMRDGHIEQAGTPDEVFKRPATQFVAGFIGSPPMN 240 Query: 241 FLPAVVIGQ----AEGGQVTV--ALKARPDTQLTVACATPPQGGDAVTVGVRPE------ 288 A V G A G ++ + KAR G VT G+RP+ Sbjct: 241 MAEATVKGNELLFANGDRLPLPARFKARVGE------------GAKVTFGLRPDDIFPKG 288 Query: 289 HFLPAGSGDTQLTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEIAVGIS 348 H L G G + V + E LGN + V+A E + R + G+ IA+ Sbjct: 289 HGLSTGDGVHEKELRVVITEPLGNETLVFAEFAGREWVARMLNPRPM--QPGESIAMQFD 346 Query: 349 AKTSFLFDAS 358 + LFDA+ Sbjct: 347 LAQAHLFDAA 356 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 363 Length adjustment: 29 Effective length of query: 334 Effective length of database: 334 Effective search space: 111556 Effective search space used: 111556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory