Align LacK, component of Lactose porter (characterized)
to candidate WP_008510203.1 BIBO1_RS16720 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::Q01937 (363 letters) >NCBI__GCF_000182725.1:WP_008510203.1 Length = 351 Score = 342 bits (877), Expect = 9e-99 Identities = 190/368 (51%), Positives = 249/368 (67%), Gaps = 25/368 (6%) Query: 1 MAEVRLTDIRKSYG-SLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGE 59 M+++ L ++RKSYG ++EVIKGV+LE++ GEFVV VGPSGCGKSTLLRMIAGLE I+SG Sbjct: 1 MSKIVLDNVRKSYGGNIEVIKGVSLEIADGEFVVLVGPSGCGKSTLLRMIAGLESITSGT 60 Query: 60 LTIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAK 119 ++IG V+N+V+P++R IAMVFQ YALYPHMTVREN+ + L+ K+EIERR+ AAK Sbjct: 61 ISIGERVVNNVEPAERDIAMVFQNYALYPHMTVRENLAYGLKNRKTPKEEIERRIAKAAK 120 Query: 120 ILELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARL 179 LE++ ++RKP+ LSGGQRQRVA+GRAIVR+P FLFDEPLSNLDA+LRV MRVEI RL Sbjct: 121 ALEIEQFLERKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMRVEIKRL 180 Query: 180 HKELNATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRM 239 + L T VYVTHDQ+EAMT+AD++VV+ G +EQVG P+ LY+ P + FVA FIGSP M Sbjct: 181 QRSLGTTSVYVTHDQMEAMTMADRLVVLNAGHIEQVGTPIELYEKPASTFVATFIGSPSM 240 Query: 240 NFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQGGDAVTVGVRPEHFLPAGSGDT- 298 N L Q + + +P + +T+ P GG T GVRPE GD Sbjct: 241 NLL-----------QSSESAAWQPGSAITL-----PSGG--YTFGVRPEDIRILEEGDQD 282 Query: 299 ----QLTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRHGGRYGDEIAVGISAKTSFL 354 ++ VE +G SY++A G+ +I + R + + VG SA + Sbjct: 283 ADGFNAQVRIEAVELVGAESYIHAALSDGKPLIF-RVAGRSTHNIDEMVRVGASATDVHI 341 Query: 355 FDASGRRI 362 F A GRR+ Sbjct: 342 FGADGRRV 349 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 351 Length adjustment: 29 Effective length of query: 334 Effective length of database: 322 Effective search space: 107548 Effective search space used: 107548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory