Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_008506742.1 BIBO1_RS10835 aldehyde dehydrogenase family protein
Query= BRENDA::P77674 (474 letters) >NCBI__GCF_000182725.1:WP_008506742.1 Length = 505 Score = 309 bits (792), Expect = 1e-88 Identities = 179/463 (38%), Positives = 255/463 (55%), Gaps = 15/463 (3%) Query: 23 NPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTPKVRAECLLKLADVIEENGQVFA 82 +P G VL E+A + A V+AA+ AA AA WG+T+ RA L ++AD IEEN A Sbjct: 39 SPVNGQVLCEVARSDAADVEAALDAAHAAKELWGRTSVAERALILNRIADRIEENLPALA 98 Query: 83 ELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNGLAAGEYLEGHTSMIRRDPLGVV 142 E+ + GKP+ N ++P VD FR+FAG R G E + +PLGVV Sbjct: 99 AAETWDNGKPIRETTNADLPLAVDHFRYFAGVIRAQEG-GISEIDHDTVAYHFHEPLGVV 157 Query: 143 ASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLTALKLAELAKDIFPAGVINILFG 202 I PWN+PL+MA WKLAPALAAGNCVVLKP+E TP + L L EL DI P GV+NI+ G Sbjct: 158 GQIIPWNFPLLMATWKLAPALAAGNCVVLKPAEQTPASILVLMELIADILPPGVVNIVNG 217 Query: 203 RGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSIKRTHMELGGKAPVIVF------ 256 G G PL P++ ++ TG TG I+ + + ++ +ELGGK+P I F Sbjct: 218 FGLEAGKPLASSPRIAKIAFTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAE 277 Query: 257 DDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDES 316 DD ++ +EG F N G+ CT R Q+ IYD +EK V + G P D + Sbjct: 278 DDDFLDKAIEGFVMFA-LNQGEVCTCPSRALIQESIYDRFMEKALKRVEAIVQGDPLDPA 336 Query: 317 TELGPLSSLAHLERVGKAVEEAKATGHIKVITGGEKRK-----GNGYYYAPTLLAGALQD 371 T +G +S LE++ ++ + G +V+ GGE+ GYY PT+ G Sbjct: 337 TMIGAQASSEQLEKILSYLDIGRQEG-AEVLAGGERNMLPGDLAGGYYVKPTVFKGH-NK 394 Query: 372 DAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHRVSARLQYGCTW 431 I Q+E+FGPVVSV F ++ + ++ AND+ YGL + +WT+D RA+R +Q G W Sbjct: 395 MRIFQEEIFGPVVSVATFKDDAEALSIANDTLYGLGAGIWTRDGTRAYRFGRAIQAGRVW 454 Query: 432 VNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVKH 474 N + + GG K SG G++ L L+ Y ++++V + Sbjct: 455 TNCYHAYPAHAAFGGYKQSGIGRENHLKMLDHYQNTKNMLVSY 497 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 505 Length adjustment: 34 Effective length of query: 440 Effective length of database: 471 Effective search space: 207240 Effective search space used: 207240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory