Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_008510203.1 BIBO1_RS16720 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000182725.1:WP_008510203.1 Length = 351 Score = 338 bits (868), Expect = 1e-97 Identities = 186/364 (51%), Positives = 253/364 (69%), Gaps = 23/364 (6%) Query: 1 MTGLLLKDIRKSYGA-VDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGD 59 M+ ++L ++RKSYG ++VI G+ L+I +GEFVV VGPSGCGKSTLLRMIAGLE IT G Sbjct: 1 MSKIVLDNVRKSYGGNIEVIKGVSLEIADGEFVVLVGPSGCGKSTLLRMIAGLESITSGT 60 Query: 60 MFIDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAAD 119 + I VN+V P++R IAMVFQ+YALYPHMTV +N+A+G++ + KEEI+RR+ AA Sbjct: 61 ISIGERVVNNVEPAERDIAMVFQNYALYPHMTVRENLAYGLKNRKTPKEEIERRIAKAAK 120 Query: 120 MLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKL 179 L++ +L+R P+ LSGGQRQRVA+GRAI R P FLFDEPLSNLDA LRV R+EI +L Sbjct: 121 ALEIEQFLERKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMRVEIKRL 180 Query: 180 SERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPA 239 +R TT +YVTHDQ+EAMT+ADR+VVL+AGHIEQVG P+ELYE+PA+ FVA FIGSP+ Sbjct: 181 -QRSLGTTSVYVTHDQMEAMTMADRLVVLNAGHIEQVGTPIELYEKPASTFVATFIGSPS 239 Query: 240 MNVIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTE-----AD 294 MN++ ++ +A Q G ++TL G T FGVRPED+R+ E AD Sbjct: 240 MNLLQSSESAAWQP-------GSAITL------PSGGYT--FGVRPEDIRILEEGDQDAD 284 Query: 295 DFLFEGTVSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFD 354 F + + VE +G + ++ L + +P+I ++ G + + VR A +H+F Sbjct: 285 GFNAQVRIEAVELVGAESYIH-AALSDGKPLIFRVAGRSTHNIDEMVRVGASATDVHIFG 343 Query: 355 TNGQ 358 +G+ Sbjct: 344 ADGR 347 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 351 Length adjustment: 29 Effective length of query: 333 Effective length of database: 322 Effective search space: 107226 Effective search space used: 107226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory