Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_008509836.1 BIBO1_RS16200 ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_000182725.1:WP_008509836.1 Length = 333 Score = 280 bits (716), Expect = 4e-80 Identities = 165/364 (45%), Positives = 221/364 (60%), Gaps = 39/364 (10%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA + L + K++ G E +K ++DI+ EF VFVGPSGCGK+T LR+IAGLE+IT G Sbjct: 1 MAELQLRDVRKSF-GSFE-VIKGVDMDIRPGEFMVFVGPSGCGKSTLLRLIAGLEEITSG 58 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 L I VN+ P R IAMVFQ+YALYPHMTVY+NMAFG++L + E R+ AA Sbjct: 59 TLSINGAVVNNFNPSRRGIAMVFQSYALYPHMTVYENMAFGMQLASKSRQECKARIHAAA 118 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 ++L + L+R P+ LSGGQRQRVA+GRAIVR+P+VFL DEPLSNLDA LRV R EI + Sbjct: 119 EMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEIAR 178 Query: 181 LHQRLQ-TTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSP 239 LHQ ++ TT+IYVTHDQ EAMT+ DRI V+RDG ++Q TP +Y +P ++FVAGFIGSP Sbjct: 179 LHQSMEDTTMIYVTHDQVEAMTLADRICVLRDGRVEQIGTPLELYEKPNSLFVAGFIGSP 238 Query: 240 AMNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVF 299 MNF+ G + F A ++ LR L + PE H Sbjct: 239 KMNFLTGPHAEP-----FGAHTVGLRSEH-----------------LAIVPERGH----- 271 Query: 300 MTTYPDSVLQMQVEVVEHMGSEVYLHTSIG-PNTIVARVNPRHVYHVGSSVKLAIDLNKI 358 QV E +GS+ Y++ +G +V R + G ++ ++ + + Sbjct: 272 --------WSGQVVHTEILGSDTYVYIDLGLEEPLVVRESGVSARKPGEALSISPTGDHV 323 Query: 359 HIFD 362 H FD Sbjct: 324 HRFD 327 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 333 Length adjustment: 29 Effective length of query: 355 Effective length of database: 304 Effective search space: 107920 Effective search space used: 107920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory