Align NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; EC 1.1.1.138 (characterized)
to candidate WP_025200128.1 BIBO1_RS11530 7-alpha-hydroxysteroid dehydrogenase
Query= SwissProt::O93868 (262 letters) >NCBI__GCF_000182725.1:WP_025200128.1 Length = 304 Score = 102 bits (254), Expect = 9e-27 Identities = 74/245 (30%), Positives = 122/245 (49%), Gaps = 11/245 (4%) Query: 15 IVTGGNRGIGLAFTRAVAAAGANVAVIYRSAKDAVEVTEKVGKEFGVKTKAYQCDVSNTD 74 IVTG GIG A A AGA+V V ++ A V + ++ G K +C+V++ Sbjct: 64 IVTGAAAGIGRAIAGTFAKAGASVVVTDLKSEGAEAVAATI-RQAGGKAIGLECNVTDEQ 122 Query: 75 IVTKTIQQIDADLGAISGLIANAGVSVVKPATELTHEDFKFVYDVNVFGVFNTCRAVAKL 134 I+ G I+ L+ NAG KP ++ DF++ + +N+F VF + A Sbjct: 123 HREAVIKAALDQFGKITVLVNNAGGGGPKPF-DMPLSDFEWAFKLNLFSVFRLSQLAAP- 180 Query: 135 WLQKQQKGSIVVTSSMSSQIINQSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRV 194 +QK G+I+ SSM+ + N ++ Y SSKAA ++L + +A + GIRV Sbjct: 181 HMQKAGHGAILNISSMAGE-------NTNVRMASYGSSKAAVNHLTRNIAFDVGPMGIRV 233 Query: 195 NALSPGYVNTDQTAH-MDKKIRDHQASNIPLNRFAQPEEMTGQAILLLSDHATYMTGGEY 253 NA++PG + TD A + +I + PL R + +++ A+ L S A +++G Sbjct: 234 NAIAPGAIKTDALATVLTPEIERAMLKHTPLGRLGEAQDIANAALFLCSPAAAWISGQVL 293 Query: 254 FIDGG 258 + GG Sbjct: 294 TVSGG 298 Lambda K H 0.317 0.130 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 304 Length adjustment: 26 Effective length of query: 236 Effective length of database: 278 Effective search space: 65608 Effective search space used: 65608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory