Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_008510203.1 BIBO1_RS16720 sn-glycerol-3-phosphate import ATP-binding protein UgpC
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000182725.1:WP_008510203.1 Length = 351 Score = 340 bits (873), Expect = 2e-98 Identities = 183/347 (52%), Positives = 240/347 (69%), Gaps = 17/347 (4%) Query: 1 MGKITLRNVQKRFGEAV-VIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQ 59 M KI L NV+K +G + VI + L+I DGEFVV VGPSGCGKSTLLR+IAGLE ++ G Sbjct: 1 MSKIVLDNVRKSYGGNIEVIKGVSLEIADGEFVVLVGPSGCGKSTLLRMIAGLESITSGT 60 Query: 60 IMIDGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAK 119 I I R + PA+R +AMVFQ+YALYPHMTV++N+A+ L+ K +EIERR++ AAK Sbjct: 61 ISIGERVVNNVEPAERDIAMVFQNYALYPHMTVRENLAYGLKNRKTPKEEIERRIAKAAK 120 Query: 120 ILNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITEL 179 L + +L+R+P QLSGGQRQRVA+GRAIVREPAAFLFDEPLSNLDA LRV MR+EI L Sbjct: 121 ALEIEQFLERKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMRVEIKRL 180 Query: 180 HQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKM 239 +SL TT +YVTHDQ+EAMTMAD++VVLNAG IEQVG+P+ LY PA+ FVA FIGSP M Sbjct: 181 QRSLGTTSVYVTHDQMEAMTMADRLVVLNAGHIEQVGTPIELYEKPASTFVATFIGSPSM 240 Query: 240 NLIEGPEAA----------KHGATTIGIRPEHIDL----SREAGAWEGEVGVS--EHLGS 283 NL++ E+A G T G+RPE I + ++A + +V + E +G+ Sbjct: 241 NLLQSSESAAWQPGSAITLPSGGYTFGVRPEDIRILEEGDQDADGFNAQVRIEAVELVGA 300 Query: 284 DTFLHVHVAGMPTLTVRTGGEFGVHHGDRVWLTPQADKIHRFGADGK 330 ++++H ++ L R G + + V + A +H FGADG+ Sbjct: 301 ESYIHAALSDGKPLIFRVAGRSTHNIDEMVRVGASATDVHIFGADGR 347 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 351 Length adjustment: 29 Effective length of query: 303 Effective length of database: 322 Effective search space: 97566 Effective search space used: 97566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory