Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_008510722.1 BIBO1_RS17945 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000182725.1:WP_008510722.1 Length = 350 Score = 331 bits (849), Expect = 1e-95 Identities = 182/345 (52%), Positives = 232/345 (67%), Gaps = 23/345 (6%) Query: 1 MGKITLRNVQKRFGEAVVIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQI 60 M +++LR + K FG+ V+ +DL+I GEF+V VGPSGCGKSTLLR++AGLE +S G + Sbjct: 1 MKEVSLRGITKTFGQLTVLDRIDLEIHSGEFLVLVGPSGCGKSTLLRMVAGLEPISGGDL 60 Query: 61 MIDGRDATEMPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKI 120 +I G A E+ P KR +AMVFQSYAL+PHMT ++NI F R+ + E +V +AA I Sbjct: 61 VIGGERANELAPQKRNIAMVFQSYALFPHMTARENIGFGPRIRGEKAAETAAKVDHAASI 120 Query: 121 LNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITELH 180 LNL +YLDR P QLSGGQRQRVA+GRAIVREP+ FLFDEPLSNLDA LRV MR EI LH Sbjct: 121 LNLHSYLDRYPRQLSGGQRQRVAMGRAIVREPSVFLFDEPLSNLDAQLRVQMRTEIKALH 180 Query: 181 QSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPKMN 240 Q L++T+IYVTHDQ+EAMTMAD+IVV+N G+I+Q+G+PL LY PAN FVAGFIGSP M+ Sbjct: 181 QRLKSTVIYVTHDQIEAMTMADRIVVMNQGKIQQIGAPLDLYDRPANKFVAGFIGSPSMS 240 Query: 241 LIEGP----------------EAAKHG--ATTIGIRPEHIDLSREAGAWEGEVGVSEHLG 282 I G AA G A GIRPE+ ++RE V V E G Sbjct: 241 FIPGTVADGFFCTGEGEKIAVSAAAKGARAAEAGIRPENFVIAREGAGLTLVVEVIEPTG 300 Query: 283 SDTFLHVHVAGMPTLTVRTGGEFGVH--HGDRVWLTPQADKIHRF 325 +T ++ +AG P VR +H G++V +T ++ IH F Sbjct: 301 PETHIYGRIAGEP---VRAVFRERIHLAPGEQVPVTAGSEHIHLF 342 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 350 Length adjustment: 28 Effective length of query: 304 Effective length of database: 322 Effective search space: 97888 Effective search space used: 97888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory