Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate WP_008510411.1 BIBO1_RS17185 acyl-CoA dehydrogenase
Query= BRENDA::Q96329 (436 letters) >NCBI__GCF_000182725.1:WP_008510411.1 Length = 375 Score = 167 bits (424), Expect = 4e-46 Identities = 114/372 (30%), Positives = 182/372 (48%), Gaps = 5/372 (1%) Query: 54 LLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI-KGYGCPG 112 LLT ++ IR+ R+ ++ +AP + FP ++GA+G G + + +G Sbjct: 2 LLTDTQEQIREAARDFAQERLAPGAAARDHEHAFPRAELTEMGALGFLGMLVPEEWGGSD 61 Query: 113 LSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACW 172 L + A A+A EIA D +CST + VHSS+G + I G+E QK ++LP +A + + Sbjct: 62 LGMVAYALALEEIAAGDGACSTIVSVHSSVGCMPILRFGTEDQKRRFLPKMASGEWIGGF 121 Query: 173 ALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTT---NQING 229 ALTEP GSDAS L T A + I+G K++I + +++I+FA I+ Sbjct: 122 ALTEPQAGSDASALKTRARLDGDHYVIDGSKQFITSGKNGNVVIVFAVTDPAAGKKGISA 181 Query: 230 FIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGV-NSFQDTSKVLAVSR 288 FIV D PG + + +K+G + N+ VP E+RL ++ L R Sbjct: 182 FIVPTDTPGYEVMSVEHKLGQHSSDTCALGFTNMRVPVENRLGAEGEGYKIALANLEGGR 241 Query: 289 VMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLC 348 + +A Q +G++ ++ Y +ER FG P+ Q +L M ++ M Sbjct: 242 IGIAAQAVGMARAAFEAARDYARERITFGKPIIEHQAVAFRLADMATRIETARQMVLHAA 301 Query: 349 KLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYE 408 L E G+ +AS+ K S A + S ++ GG G LAD+ V + + D+ YE Sbjct: 302 ALREAGKPCLTEASMAKLVASEMAEQVCSAAIQIHGGYGYLADYPVERIYRDVRVCQIYE 361 Query: 409 GTYDINTLVTGR 420 GT D+ LV R Sbjct: 362 GTSDVQRLVIAR 373 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 375 Length adjustment: 31 Effective length of query: 405 Effective length of database: 344 Effective search space: 139320 Effective search space used: 139320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory