Align 4-aminobutyrate aminotransferase; EC 2.6.1.19 (characterized, see rationale)
to candidate WP_002968535.1 BIBO1_RS18510 aspartate aminotransferase family protein
Query= uniprot:A1S8Y2 (425 letters) >NCBI__GCF_000182725.1:WP_002968535.1 Length = 484 Score = 178 bits (451), Expect = 4e-49 Identities = 121/356 (33%), Positives = 179/356 (50%), Gaps = 28/356 (7%) Query: 24 HPVFTERAENATVWDVEGREYIDFAGGIAVLNTGHLHPKVKAAVAEQLEKFSHTCFMVLG 83 H V ERAE +D GR +DF GG L GH HP++ AA + E+ H + Sbjct: 61 HKVKVERAEGMYYYDQNGRRILDFFGGFGSLAFGHNHPRIIAARRKFQEELRHEIAIAFM 120 Query: 84 YESYVAVCEKLNQLVPGDFAKKSALFTSGSEAVENAIKVAR--AYTKRAGVIAFTSGYHG 141 + A+ L PGD L +SGSEA+E AIKVA A K+ ++ + +HG Sbjct: 121 SQYAAALAYDLAACSPGDL-DMVFLGSSGSEAMEAAIKVAERAAGPKKPKIVYAENSFHG 179 Query: 142 RTMAALALTGKVAPYSKGMGLMQANVFRAEFPCALHGVSEDDA-MASIERIFKNDAEPSD 200 +T L++T ++R EF + V + +IE F++D E Sbjct: 180 KTKGVLSIT-------------DGGLYRGEFKLVDNTVRVPFGDITAIENAFRSDPE--- 223 Query: 201 IAAIILEPVQGEGGFYAATPGFMKRLRELCDREGIMLIADEVQTGAGRTGTFFAMEQMGV 260 I I+LE VQG GG A F ++LR+LCDR G++ +ADEVQ G GRTG F+A E GV Sbjct: 224 IGTIVLETVQGGGGIIQADAEFWQKLRQLCDRYGVIWVADEVQCGFGRTGKFYAFEHYGV 283 Query: 261 AADITTFAKSIAGG-FPLSGITGRAEV-MDAIGPGGLG-----GTYGGSPLACAAALAVI 313 D+T AKS+ GG ++ + R ++ M A G T+GG AC A+ + Sbjct: 284 IPDVTALAKSLGGGKAAMAAMIARRDIYMKAYGTPKTAMIHAMATFGGIGEACITAIEAV 343 Query: 314 EVFEEEKLLERSNAIGQTIKSAIGELASRYP-QIAEVRGLGSMIAIELMENGKPAP 368 + +E+L++ S +G + + EL RYP + +VRG G M+ +E + + P Sbjct: 344 NILYDEQLIDNSAEVGDYLLERLKELQVRYPGLLKDVRGKGMMVGLEFHDFSQAMP 399 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 484 Length adjustment: 33 Effective length of query: 392 Effective length of database: 451 Effective search space: 176792 Effective search space used: 176792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory