Align 2-keto-3-deoxy-L-rhamnonate aldolase (EC 4.1.2.53) (characterized)
to candidate WP_008505507.1 BIBO1_RS08940 HpcH/HpaI aldolase/citrate lyase family protein
Query= BRENDA::P76469 (267 letters) >NCBI__GCF_000182725.1:WP_008505507.1 Length = 255 Score = 127 bits (320), Expect = 2e-34 Identities = 77/239 (32%), Positives = 115/239 (48%), Gaps = 3/239 (1%) Query: 5 LSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAV 64 +S RLR GE + W S EI A S +D + +D +H + + H L V Sbjct: 1 MSMSLSSRLRAGETVLSAWSSLPEPLTVEILAHSVFDAVTLDMQHGGHDEASILHSLGLV 60 Query: 65 APYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGA 124 PV+R G + + LD GA ++ PM+++ + AR+ +A +YPP GER G Sbjct: 61 LNAGKPPVVRIPVGRFDMASRALDFGAHAVIAPMINSVDDARRFAAAMKYPPVGERSWGV 120 Query: 125 SVARAARWGRIEN-YMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSA- 182 A A N Y+ N +E++ A D LD ILDV GIDGVF+GP+D S Sbjct: 121 FRANADYGAPGSNDYLTTANHDTLAFAMIETRDAYDALDAILDVRGIDGVFVGPSDFSIA 180 Query: 183 -SLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDT 240 S G N + I + AAGK AG + +P+ A++ ++ G F+ + D+ Sbjct: 181 WSNGREANPHSDAIVEPISNIAHKAAAAGKIAGIYSPSPEFARRYISLGFQFLTISNDS 239 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 255 Length adjustment: 25 Effective length of query: 242 Effective length of database: 230 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory