Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_002965777.1 BIBO1_RS18585 triose-phosphate isomerase
Query= BRENDA::Q7X216 (265 letters) >NCBI__GCF_000182725.1:WP_002965777.1 Length = 256 Score = 206 bits (525), Expect = 3e-58 Identities = 121/260 (46%), Positives = 160/260 (61%), Gaps = 18/260 (6%) Query: 2 MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPSFTAIQPVSHFLQTHQ 61 MT W+GTSWKMNK L++A + E L A G P IQ FVIP FTA++ V L Sbjct: 1 MTKFWIGTSWKMNKTLAEARLFAEALKAA-DAGRSPDIQRFVIPPFTAVREVKEILSGTS 59 Query: 62 LPLLTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA 121 + + GAQNMH ADQGAWTGEIS ML + +VELGHSERR F E++ + KV +A Sbjct: 60 VKV--GAQNMHWADQGAWTGEISPLMLKDCNLDIVELGHSERREHFGETNETVGLKVEAA 117 Query: 122 LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSH-QQALRTLIAYEPVWAIGEH 180 + HGL PLICIG++ E++ + + +++ AL LS Q+ L AYEPVWAIGE+ Sbjct: 118 VRHGLIPLICIGETLEDRESGRAAAVLEEEVRGALSKLSEAQKQAEILFAYEPVWAIGEN 177 Query: 181 GTPAS-----PQEAGVIHQALRQALCERFGHETGTRIPLLYGGXVTLQNAVELLRQQEIN 235 G PAS ++A +I A+ Q++ R R+P LYGG V N EL+ I+ Sbjct: 178 GIPASADYADARQAEII--AVAQSVLAR-------RVPCLYGGSVNPGNCEELIACPHID 228 Query: 236 GLFIGRAAWDAQGYCDIVQR 255 GLFIGR+AW+ +GY DI+ R Sbjct: 229 GLFIGRSAWNVEGYLDILAR 248 Lambda K H 0.321 0.133 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 256 Length adjustment: 24 Effective length of query: 241 Effective length of database: 232 Effective search space: 55912 Effective search space used: 55912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory