Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate WP_008507129.1 BIBO1_RS11575 D-threitol dehydrogenase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >NCBI__GCF_000182725.1:WP_008507129.1 Length = 257 Score = 117 bits (293), Expect = 2e-31 Identities = 89/265 (33%), Positives = 133/265 (50%), Gaps = 29/265 (10%) Query: 7 LKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHG----GDKHQSSGNYNFWPTDISS 62 L EK+ VTGGASGIG AI +A+GA V ++DI + N + D+SS Sbjct: 14 LSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAKAKAEELGENAKPFVCDVSS 73 Query: 63 ASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNINQKG 122 V+ + +I +FG+ID VN+AGV + AP+ L+ ++K +NIN KG Sbjct: 74 QQSVNDAITAVITQFGKIDIAVNSAGVVY-------LAPAEDISLD--YWDKTININLKG 124 Query: 123 VFLMSQAVARQMVKQ-RSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKELGKH 181 FL++QAV R M+ G I+N++S++G E Y A+K + +++++ E GKH Sbjct: 125 SFLVTQAVGRAMIAAGNGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGKH 184 Query: 182 GIRVVGVAPGI-LEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLGRSGRLTEVAD 240 GI V ++P I L + G + E+ A +K IP GR E+A Sbjct: 185 GICVNTLSPTIVLTELGKKAWAGEKGEA--------------AKKRIPAGRFAYPEEIAA 230 Query: 241 FVCYLLSERASYMTGVTTNIAGGKT 265 +L S A +TG I GG T Sbjct: 231 AAVFLASAGADMITGADLLIDGGYT 255 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 257 Length adjustment: 25 Effective length of query: 242 Effective length of database: 232 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory